Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ieramilimab Biosimilar – Anti-LAG3 mAb – Research Grade

  • PX-TA1562-100UG
  • Validated ELISA
Isotype:
IgG4, Kappa

Original price was: €152.00.Current price is: €120.00.

100ug 21% OFF + 120 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade

Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name PX-TA1562-50
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Source CAS 2137049-37-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ieramilimab ,LAG-525,LAG3 ,anti-LAG3
Reference PX-TA1562
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody

Introduction:

Ieramilimab Biosimilar, also known as Anti-LAG3 mAb, is a research grade monoclonal antibody that has shown promising results in pre-clinical studies as a potential therapeutic target for various diseases. This article will provide a detailed description of the structure, activity, and potential applications of Ieramilimab Biosimilar in the field of immunotherapy.

Structure of Ieramilimab Biosimilar:

Ieramilimab Biosimilar is a humanized monoclonal antibody that targets the lymphocyte activation gene 3 (LAG3) protein. It is composed of two identical heavy chains and two identical light chains, each containing a variable and constant region. The variable region of the antibody is responsible for binding to the LAG3 protein, while the constant region determines the effector function of the antibody.

Activity of Ieramilimab Biosimilar:

LAG3 is a cell surface protein that is primarily expressed on activated T cells and natural killer (NK) cells. It plays a crucial role in regulating immune responses by inhibiting the activation and proliferation of T cells. However, in certain diseases, such as cancer and autoimmune disorders, LAG3 expression is upregulated, leading to immune suppression and disease progression. Ieramilimab Biosimilar works by binding to LAG3 and blocking its inhibitory function, thereby promoting immune responses against cancer cells or reducing autoimmunity.

Potential Applications of Ieramilimab Biosimilar:

1.

Cancer Immunotherapy:

One of the most promising applications of Ieramilimab Biosimilar is in the field of cancer immunotherapy. By targeting LAG3, this antibody can enhance the anti-tumor immune response and potentially improve the efficacy of other cancer therapies. Pre-clinical studies have shown that Ieramilimab Biosimilar can inhibit tumor growth and improve survival rates in various cancer models, including melanoma, lung cancer, and breast cancer.

2.

Autoimmune Disorders:

Autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis, are characterized by an overactive immune response against the body’s own tissues. LAG3 is known to play a role in the development and progression of these diseases. By blocking LAG3, Ieramilimab Biosimilar can potentially reduce the activity of autoreactive T cells and alleviate symptoms of autoimmune disorders.

3.

Infectious Diseases:

LAG3 has also been implicated in the immune response against certain infectious diseases, such as HIV and tuberculosis. Pre-clinical studies have shown that Ieramilimab Biosimilar can enhance the immune response against these pathogens and potentially improve the efficacy of current treatments.

4. Combination Therapy:

Due to its unique mechanism of action, Ieramilimab Biosimilar has the potential to be used in combination with other immunotherapies, such as checkpoint inhibitors and CAR T cell therapy. This combination approach can potentially enhance the anti-tumor immune response and improve treatment outcomes for cancer patients.

Conclusion:

In conclusion, Ieramilimab Biosimilar is a promising research grade monoclonal antibody that targets LAG3 and has shown potential in the treatment of various diseases, including cancer, autoimmune disorders, and infectious diseases. Its unique mechanism of action and potential for combination therapy make it an exciting candidate for further development in the field of immunotherapy. Further clinical studies are needed to fully explore the potential of Ieramilimab Biosimilar and its role in the treatment of these diseases.

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind to Ieramilimab Biosimilar - Anti-LAG3 mAb (cat. No.PX-TA1562) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade

SDS-PAGE for Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade

Ieramilimab Biosimilar - Anti-LAG3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ieramilimab  Biosimilar - Anti-LAG3  mAb - Research Grade

There are no reviews yet.

Be the first to review “Ieramilimab Biosimilar – Anti-LAG3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products