Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fianlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade

  • PX-TA1588-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €174.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Fianlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

Product name Fianlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 2126132-98-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fianlimab ,REGN3767,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1588
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Fianlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 2126132-98-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fianlimab ,REGN3767,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1588
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1588-50
Uniprot ID P18627
Source CAS 2126132-98-5
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fianlimab ,REGN3767,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1588
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Fianlimab Biosimilar is a novel antibody that targets the protein LAG3, also known as CD223. This antibody has been developed as a biosimilar of the existing anti-LAG3 antibody, with the aim of providing a more affordable and accessible treatment option for patients. In this article, we will explore the structure, activity, and potential applications of Fianlimab Biosimilar as a therapeutic agent.

Structure of Fianlimab Biosimilar

Fianlimab Biosimilar is a monoclonal antibody, meaning it is derived from a single type of immune cell. It is a humanized antibody, which means that it has been modified to contain both human and non-human components. This modification is important as it reduces the risk of an immune response against the antibody when administered to patients.

The antibody has a Y-shaped structure, with two arms that can bind to the LAG3 protein. The binding site of Fianlimab Biosimilar is located on the variable region of the antibody, which is specifically designed to recognize and bind to LAG3 with high affinity.

Activity of Fianlimab Biosimilar

Fianlimab Biosimilar works by blocking the activity of LAG3, a protein found on the surface of immune cells. LAG3 is known to play a role in regulating the activity of T cells, a type of white blood cell that is crucial for the body’s immune response. When LAG3 is activated, it inhibits the function of T cells, leading to a weakened immune response.

By blocking LAG3, Fianlimab Biosimilar allows T cells to function more effectively, leading to a stronger immune response against cancer cells or other disease-causing agents. This activity of Fianlimab Biosimilar makes it a promising therapeutic agent for the treatment of various diseases, particularly cancer.

Potential Applications of Fianlimab Biosimilar

As a biosimilar of the existing anti-LAG3 antibody, Fianlimab Biosimilar is being developed for the treatment of various types of cancer. LAG3 has been found to be overexpressed in several types of cancer, including melanoma, lung cancer, and ovarian cancer. Therefore, by targeting LAG3, Fianlimab Biosimilar has the potential to be an effective treatment for these cancers.

Additionally, Fianlimab Biosimilar may also have applications in autoimmune diseases. LAG3 has been implicated in the development of autoimmune disorders, and by blocking its activity, Fianlimab Biosimilar may help in managing these conditions.

Conclusion

In summary, Fianlimab Biosimilar is a novel antibody that targets the protein LAG3. Its structure, as a humanized monoclonal antibody, allows for high affinity binding to LAG3. By blocking the activity of LAG3, Fianlimab Biosimilar has the potential to be an effective treatment for various types of cancer and autoimmune diseases. As research on this biosimilar continues, it may provide a more accessible and affordable option for patients in need of anti-LAG3 therapy.

SDS-PAGE for Fianlimab Biosimilar - Anti-CD223;LAG3 mAb - Research Grade

SDS-PAGE for Fianlimab Biosimilar - Anti-CD223;LAG3 mAb - Research Grade

Fianlimab Biosimilar - Anti-CD223;LAG3 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Fianlimab  Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

There are no reviews yet.

Be the first to review “Fianlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products