Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Encelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Encelimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

Product name Encelimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Encelimab ,TSR-033,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1586
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Encelimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Encelimab ,TSR-033,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1586
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1586-50
Uniprot ID P18627
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Encelimab ,TSR-033,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1586
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Encelimab Biosimilar, also known as Anti-LAG3 or CD223 monoclonal antibody, is a research grade therapeutic antibody that targets the Lymphocyte Activation Gene 3 (LAG3) protein. LAG3 is a cell surface molecule that is primarily expressed on immune cells and plays a critical role in regulating immune responses. Encelimab Biosimilar is a promising new treatment option for various autoimmune diseases and cancers, and its unique structure and mechanism of action make it a highly sought-after therapeutic target.

Structure of Encelimab Biosimilar

Encelimab Biosimilar is a monoclonal antibody, meaning it is a laboratory-produced protein that is designed to mimic the function of natural antibodies in the body. It is composed of two heavy chains and two light chains, which are held together by disulfide bonds. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) at the end of each arm and a crystallizable fragment (Fc) at the base.

The Fab regions of Encelimab Biosimilar are responsible for binding to the LAG3 protein, while the Fc region is responsible for activating immune cells and promoting antibody-mediated cellular cytotoxicity (ADCC) and antibody-dependent cellular phagocytosis (ADCP). This dual mechanism of action makes Encelimab Biosimilar a potent therapeutic agent for targeting LAG3.

Activity of Encelimab Biosimilar

Encelimab Biosimilar works by binding to the LAG3 protein on the surface of immune cells, including T cells, B cells, and natural killer (NK) cells. This binding prevents LAG3 from interacting with its natural ligands, such as major histocompatibility complex (MHC) class II molecules, which are essential for immune cell activation and function.

By blocking the interaction between LAG3 and its ligands, Encelimab Biosimilar helps to restore proper immune function and balance. It can also enhance the activity of other immune cells, such as T cells and NK cells, by promoting their activation and proliferation. In addition, the Fc region of Encelimab Biosimilar can trigger the destruction of LAG3-expressing cells through ADCC and ADCP, further contributing to its therapeutic activity.

Applications of Encelimab Biosimilar

Encelimab Biosimilar is currently being investigated for its potential in treating various autoimmune diseases and cancers. In autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, LAG3 is overexpressed and plays a role in suppressing immune responses. By targeting LAG3, Encelimab Biosimilar can help to restore immune balance and alleviate disease symptoms.

In cancer, LAG3 is often expressed on tumor-infiltrating immune cells, which can suppress anti-tumor immune responses. By blocking LAG3, Encelimab Biosimilar can enhance the activity of immune cells against cancer cells and potentially improve the efficacy of other cancer treatments, such as chemotherapy and immunotherapy.

Conclusion

Encelimab Biosimilar, also known as Anti-LAG3 or CD223 monoclonal antibody, is a promising new therapeutic agent that targets the LAG3 protein. Its unique structure and mechanism of action make it a potent therapeutic target for various autoimmune diseases and cancers. Ongoing research and clinical trials will further elucidate the full potential of Encelimab Biosimilar in treating these diseases and improving patient outcomes.

SDS-PAGE for Encelimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

SDS-PAGE for Encelimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

Encelimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Encelimab  Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

There are no reviews yet.

Be the first to review “Encelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products