Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Relatlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €272.00.Current price is: €200.00.

100ug 26% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

Product name Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 1673516-98-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Relatlimab,BMS-986016,ONO-4482,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1496
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade
Uniprot ID P18627
Source CAS 1673516-98-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Relatlimab,BMS-986016,ONO-4482,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1496
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1496-50
Uniprot ID P18627
Source CAS 1673516-98-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Relatlimab,BMS-986016,ONO-4482,LAG3, CD223,anti-LAG3, CD223
Reference PX-TA1496
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Relatlimab Biosimilar: A Potent Anti-LAG3 Antibody for

Cancer Therapy

Relatlimab Biosimilar, also known as Anti-LAG3 or CD223 monoclonal antibody, is a promising immunotherapy drug that targets the Lymphocyte Activation Gene 3 (LAG3) protein. This protein is expressed on the surface of immune cells, such as T cells and natural killer cells, and plays a crucial role in regulating their activity. By binding to LAG3, Relatlimab Biosimilar can modulate the immune response and enhance the body’s ability to fight cancer cells. In this article, we will explore the structure, activity, and potential applications of Relatlimab Biosimilar in cancer treatment.

Structure of Relatlimab Biosimilar

Relatlimab Biosimilar is a fully humanized monoclonal antibody, meaning that it is derived from human cells and has a high degree of similarity to natural antibodies. It is composed of two heavy chains and two light chains, each with a specific amino acid sequence that determines its binding specificity. The antibody has a Y-shaped structure, with two arms that can bind to LAG3 on the surface of immune cells.

One of the key features of Relatlimab Biosimilar is its high affinity for LAG3. This means that it has a strong binding capacity and can effectively block the interaction between LAG3 and its ligands, which are molecules that activate or inhibit immune cells. By doing so, Relatlimab Biosimilar can prevent LAG3 from suppressing the immune response and promote the activation of immune cells against cancer cells.

Activity of Relatlimab Biosimilar

The main activity of Relatlimab Biosimilar is to act as an immune checkpoint inhibitor. Immune checkpoints are molecules that regulate the activity of immune cells and prevent them from attacking healthy tissues. However, cancer cells can exploit these checkpoints to evade the immune system and grow uncontrollably. By blocking the LAG3 checkpoint, Relatlimab Biosimilar can unleash the full potential of the immune system and enhance the anti-tumor response.

Moreover, Relatlimab Biosimilar has been shown to have a dual mechanism of action. On one hand, it can directly activate immune cells, such as T cells and natural killer cells, to recognize and attack cancer cells. On the other hand, it can also modulate the tumor microenvironment, which is the area surrounding the tumor, to make it more favorable for the immune system. This includes reducing the number of immune-suppressive cells and increasing the production of pro-inflammatory cytokines, which are signaling molecules that promote immune responses.

Applications of Relatlimab Biosimilar

Relatlimab Biosimilar is currently being investigated as a potential treatment for various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. It is also being studied in combination with other immunotherapies, such as anti-PD-1 antibodies, to enhance its efficacy.

Preliminary clinical trials have shown promising results, with Relatlimab Biosimilar demonstrating good safety and tolerability profiles and significant anti-tumor activity. In a phase I study, Relatlimab Biosimilar was well-tolerated and induced objective responses in patients with advanced solid tumors. In a phase II trial, it showed promising results in combination with an anti-PD-1 antibody in patients with advanced melanoma.

Furthermore, Relatlimab Biosimilar has the potential to be used as a research tool for studying the role of LAG3 in cancer and other diseases. It can also be used to develop diagnostic tests that can measure the expression of LAG3 on immune cells and predict the response to immunotherapy.

Conclusion

Relatlimab Biosimilar is a promising anti-LAG3 antibody with a unique structure and potent activity against cancer. Its ability to block immune

SDS-PAGE for Relatlimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

SDS-PAGE for Relatlimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade

Relatlimab Biosimilar - Anti-LAG3; CD223 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Relatlimab Biosimilar - Anti-LAG3, CD223 mAb - Research Grade

There are no reviews yet.

Be the first to review “Relatlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products