Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ieramilimab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ieramilimab ELISA Kit

Ieramilimab ELISA Kit

Product name Ieramilimab ELISA Kit
Uniprot ID P18627
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX202
Note For research use only.
Sample type Plasma, Serum
Target Ieramilimab
Immunogen Ieramilimab

Introduction

The Ieramilimab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Ieramilimab, a novel antibody targeting a specific therapeutic target. This kit is designed for use in scientific research and drug development, providing valuable insights into the structure, activity, and potential applications of this promising therapeutic agent.

Structure of Ieramilimab

Ieramilimab, also known as TAK-659, is a humanized monoclonal antibody that specifically binds to the protein Spleen Tyrosine Kinase (SYK). SYK is a key signaling molecule involved in the activation of immune cells, making it an attractive therapeutic target for various autoimmune and inflammatory diseases.

The Ieramilimab antibody consists of two heavy chains and two light chains, with a total molecular weight of approximately 150 kDa. It has a unique structure that allows it to bind specifically to SYK, inhibiting its activity and modulating the immune response.

Activity of Ieramilimab

The primary mechanism of action of Ieramilimab is the inhibition of SYK, which is involved in the activation of immune cells such as B-cells, T-cells, and mast cells. By binding to SYK, Ieramilimab prevents downstream signaling and activation of these cells, resulting in a reduction of inflammation and immune response.

In addition to its inhibitory effects on immune cells, Ieramilimab has also been shown to induce apoptosis (cell death) in cancer cells that overexpress SYK. This makes it a promising therapeutic agent for the treatment of certain types of cancer, such as B-cell lymphomas and leukemias.

Application of Ieramilimab

The Ieramilimab ELISA Kit has a wide range of potential applications in scientific research and drug development. Some of the key applications include:

1. Evaluation of Ieramilimab levels in biological samples The ELISA Kit allows for the accurate and quantitative measurement of Ieramilimab levels in various biological samples, such as serum, plasma, and cell culture supernatants. This is essential for monitoring the pharmacokinetics and pharmacodynamics of Ieramilimab in preclinical and clinical studies.

2. Screening of potential therapeutic targets The Ieramilimab ELISA Kit can also be used to screen for potential therapeutic targets involved in the SYK signaling pathway. By measuring the levels of Ieramilimab in the presence of different targets, researchers can identify new targets for drug development and gain a better understanding of the mechanism of action of Ieramilimab.

3. Preclinical and clinical studies The accurate and sensitive measurement of Ieramilimab levels provided by the ELISA Kit is crucial for the successful development of this therapeutic agent. It can be used to determine the optimal dosing regimen, evaluate the efficacy of Ieramilimab in preclinical and clinical studies, and monitor patient response to treatment.

4. Biomarker discovery The Ieramilimab ELISA Kit can also be used to identify potential biomarkers associated with SYK signaling and Ieramilimab treatment. This can provide valuable insights into the mechanism of action of Ieramilimab and aid in the development of personalized treatment strategies.

Conclusion

The Ieramilimab ELISA Kit is a powerful tool for the detection and quantification of this novel therapeutic antibody. Its high sensitivity and specificity make it an essential tool for researchers and drug developers interested in understanding the structure, activity, and potential applications of Ieramilimab in various diseases. With its wide range of potential applications, this kit is an invaluable resource for advancing the development of Ieramilimab as a promising therapeutic agent.

Ieramilimab ELISA Kit

There are no reviews yet.

Be the first to review “Ieramilimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products