Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tebotelimab Biosimilar – Anti-PDCD1;LAG3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Bispecific scFv ,IgG4;Kappa;Kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tebotelimab Biosimilar - Anti-PDCD1;LAG3 mAb - Research Grade

Product name Tebotelimab Biosimilar - Anti-PDCD1;LAG3 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source CAS 2245725-04-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tebotelimab,MABFRAG HUMAN (FC)MABFRAG HUMANIZED (FAB) ANTI Q15116 (PDCD1_HUMAN)MABFRAG HUMANIZED (FAB) ANTI P18627 (LAG3_HUMAN) (MGD013),,PDCD1;LAG3,anti-PDCD1;LAG3
Reference PX-TA1722
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific scFv ,IgG4;Kappa;Kappa
Clonality Monoclonal Antibody
Product name Tebotelimab Biosimilar - Anti-PDCD1;LAG3 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source CAS 2245725-04-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tebotelimab,MABFRAG HUMAN (FC)MABFRAG HUMANIZED (FAB) ANTI Q15116 (PDCD1_HUMAN)MABFRAG HUMANIZED (FAB) ANTI P18627 (LAG3_HUMAN) (MGD013),,PDCD1;LAG3,anti-PDCD1;LAG3
Reference PX-TA1722
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific scFv ,IgG4;Kappa;Kappa
Clonality Monoclonal Antibody
Product name PX-TA1722-50
Uniprot ID P18627 & Q15116
Source CAS 2245725-04-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tebotelimab,MABFRAG HUMAN (FC)MABFRAG HUMANIZED (FAB) ANTI Q15116 (PDCD1_HUMAN)MABFRAG HUMANIZED (FAB) ANTI P18627 (LAG3_HUMAN) (MGD013),,PDCD1;LAG3,anti-PDCD1;LAG3
Reference PX-TA1722
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific scFv ,IgG4;Kappa;Kappa
Clonality Monoclonal Antibody

Introduction

Tebotelimab Biosimilar, also known as Anti-PDCD1,LAG3 mAb, is a novel monoclonal antibody that has been developed as a biosimilar to the therapeutic antibody, Tebotelimab. This biosimilar is designed to target the immune checkpoint proteins, Programmed Cell Death Protein 1 (PDCD1) and Lymphocyte Activation Gene 3 (LAG3), which play a crucial role in regulating the immune response. In this article, we will provide a detailed scientific description of Tebotelimab Biosimilar, including its structure, activity, and potential applications.

Structure of Tebotelimab Biosimilar

Tebotelimab Biosimilar is a fully humanized immunoglobulin G4 (IgG4) monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chain consists of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chain contains one constant domain (CL) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the target proteins, PDCD1 and LAG3.

Activity of Tebotelimab Biosimilar

Tebotelimab Biosimilar exerts its activity by binding to PDCD1 and LAG3, which are expressed on the surface of T cells. PDCD1, also known as PD-1, is a co-inhibitory receptor that is upregulated on T cells in response to chronic antigen exposure. It interacts with its ligands, PD-L1 and PD-L2, to suppress T cell activation and prevent autoimmunity. LAG3, on the other hand, is a co-inhibitory receptor that is expressed on activated T cells and regulatory T cells (Tregs). It binds to its ligand, MHC class II, and inhibits T cell proliferation and cytokine production.

By targeting PDCD1 and LAG3, Tebotelimab Biosimilar blocks their interaction with their respective ligands, thereby releasing the inhibition on T cell activation. This leads to the activation of T cells and enhances their ability to recognize and kill cancer cells. Additionally, Tebotelimab Biosimilar may also promote the expansion and activation of Tregs, which can suppress the immune response and prevent autoimmune reactions.

Applications of Tebotelimab Biosimilar

Tebotelimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer. Its potential applications include:

1.

Cancer Immunotherapy

Tebotelimab Biosimilar is being developed as a potential immunotherapy for various types of cancer, including solid tumors and hematologic malignancies. By targeting PDCD1 and LAG3, it can enhance the anti-tumor immune response and potentially improve the efficacy of other cancer treatments, such as chemotherapy and radiation therapy.

2. Autoimmune Diseases The inhibition of PDCD1 and LAG3 by Tebotelimab Biosimilar may also have potential applications in the treatment of autoimmune diseases. By blocking the inhibitory signals, it can promote the activation of T cells and restore the balance of the immune system, thereby reducing the severity of autoimmune reactions.

3. Chronic Infections Tebotelimab Biosimilar may also be effective in treating chronic infections, such as HIV and hepatitis B and C. By enhancing T cell activation, it can improve the immune response against the viral infection and potentially lead to viral clearance.

Conclusion

In conclusion, Tebotelimab Biosimilar is a promising monoclonal antibody that targets the immune checkpoint proteins, PDCD1 and LAG3. Its unique structure and mechanism of action make it a potential candidate for the treatment of

SDS-PAGE for Tebotelimab Biosimilar - Anti-CD223;LAG3 and CD279;PD-1 mAb - Research Grade

SDS-PAGE for Tebotelimab Biosimilar - Anti-CD223;LAG3 and CD279;PD-1 mAb - Research Grade

Tebotelimab Biosimilar - Anti-CD223;LAG3 and CD279;PD-1 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Tebotelimab Biosimilar - Anti-PDCD1;LAG3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tebotelimab Biosimilar – Anti-PDCD1;LAG3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products