Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human TNFSF9-TNFSF4-1BBL recombinant protein |
|---|---|
| Uniprot ID | P41273 |
| Uniprot link | http://www.uniprot.org/uniprot/P41273 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGSHHHHHHSGACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Molecular weight | 22.64kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 50% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | 4 1BB L, 4 1BB ligand, 4 1BBL, 4-1BB ligand, 4-1BBL, Cd137l, Cd157l, Homolog of mouse 4 1BB L, Homolog of mouse 4 1BBL, ILA ligand (TNF related), Ly63l, Receptor 4 1BB ligand, TNF superfamily member 9, TNFL9_HUMAN, Tnfsf9, TNLG5A, Tumor necrosis factor (ligand) superfamily member 9, Tumor necrosis factor ligand 5A, Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor superfamily member 9 |
| Reference | PX-P4060 |
| Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.