Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €276.00.Current price is: €200.00.

100ug 28% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade

Product name Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade
Uniprot ID P01374
Source CAS 1202526-59-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pateclizumab,MLTA3698A,PRO283698,RG7416,LTA, TNFSF1,anti-LTA, TNFSF1
Reference PX-TA1273
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade
Uniprot ID P01374
Source CAS 1202526-59-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pateclizumab,MLTA3698A,PRO283698,RG7416,LTA, TNFSF1,anti-LTA, TNFSF1
Reference PX-TA1273
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1273-50
Uniprot ID P01374
Source CAS 1202526-59-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pateclizumab,MLTA3698A,PRO283698,RG7416,LTA, TNFSF1,anti-LTA, TNFSF1
Reference PX-TA1273
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Pateclizumab Biosimilar, also known as Anti-LTA, TNFSF1 mAb – Research Grade, is a monoclonal antibody that targets the tumor necrosis factor (TNF) superfamily member 1A (TNFSF1A), also known as lymphotoxin-alpha (LTA). This biosimilar is a highly specific and potent therapeutic agent that has shown promising results in the treatment of various inflammatory and autoimmune diseases.

Structure

Pateclizumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is produced through genetic engineering techniques, where the variable regions of the antibody are derived from a mouse antibody, while the constant regions are of human origin. This structure allows for a high binding affinity and specificity towards its target, TNFSF1A.

Activity

Pateclizumab Biosimilar works by binding to TNFSF1A and inhibiting its activity. TNFSF1A is a pro-inflammatory cytokine that plays a critical role in the pathogenesis of various inflammatory and autoimmune diseases. By blocking its activity, Pateclizumab Biosimilar reduces the production of other pro-inflammatory cytokines, such as TNF-alpha and IL-1, and helps to restore the balance of the immune system.

Application

Pateclizumab Biosimilar has shown promising results in the treatment of various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, and Crohn’s disease. It has also been studied in clinical trials for the treatment of multiple sclerosis and systemic lupus erythematosus.

Rheumatoid Arthritis

Rheumatoid arthritis (RA) is a chronic inflammatory disease that primarily affects the joints. It is caused by an abnormal immune response, where the body’s immune system attacks its own tissues, leading to joint inflammation and damage. Pateclizumab Biosimilar has been shown to significantly reduce the signs and symptoms of RA, such as joint pain, swelling, and stiffness, in patients who have failed to respond to conventional therapies.

Psoriasis

Psoriasis is a chronic autoimmune skin disease characterized by red, scaly patches on the skin. It is caused by an overactive immune response, which leads to the rapid growth of skin cells. Pateclizumab Biosimilar has been shown to improve the symptoms of psoriasis, such as skin lesions and itching, by inhibiting the activity of TNFSF1A and other pro-inflammatory cytokines.

Crohn’s Disease

Crohn’s disease is a chronic inflammatory bowel disease that affects the lining of the digestive tract. It is caused by an abnormal immune response, which leads to inflammation and damage in the digestive tract. Pateclizumab Biosimilar has been shown to reduce the signs and symptoms of Crohn’s disease, such as abdominal pain, diarrhea, and rectal bleeding, by targeting TNFSF1A and other pro-inflammatory cytokines.

Multiple Sclerosis

Multiple sclerosis (MS) is a chronic autoimmune disease that affects the central nervous system. It is caused by an abnormal immune response, which leads to inflammation and damage in the brain and spinal cord. Pateclizumab Biosimilar has been studied in clinical trials for the treatment of MS and has shown promising results in reducing disease activity and progression.

Systemic Lupus Erythematosus

Systemic lupus erythematosus (SLE) is a chronic autoimmune disease that can affect multiple organs, including the skin, joints, and kidneys. It is caused by an overactive immune response, which leads to inflammation and damage in various organs. Pateclizumab Biosimilar has been studied in clinical trials for the treatment of SLE and has shown promising results in reducing disease activity and improving symptoms.

Conclusion

In conclusion, Pateclizumab Biosimilar is a highly specific and potent monoclonal antibody that targets TNFSF1A, a key player in the pathogenesis of various inflammatory and autoimmune diseases. Its structure, activity, and application make it a promising therapeutic agent for the treatment of conditions such as rheumatoid arthritis, psoriasis, Crohn’s

SDS-PAGE for Pateclizumab Biosimilar - Anti-LTA;TNF-beta mAb - Research Grade

SDS-PAGE for Pateclizumab Biosimilar - Anti-LTA;TNF-beta mAb - Research Grade

Pateclizumab Biosimilar - Anti-LTA;TNF-beta mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Pateclizumab Biosimilar - Anti-LTA, TNFSF1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Pateclizumab Biosimilar – Anti-LTA, TNFSF1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products