Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human TNFSF9-TNFSF4-1BBL recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P41273
Molecular weight:
22.64kDa

€210.00

50ug + 210 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human TNFSF9-TNFSF4-1BBL recombinant protein

Human TNFSF9-TNFSF4-1BBL recombinant protein

Product name Human TNFSF9-TNFSF4-1BBL recombinant protein
Uniprot ID P41273
Uniprot link http://www.uniprot.org/uniprot/P41273
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Molecular weight 22.64kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms 4 1BB L, 4 1BB ligand, 4 1BBL, 4-1BB ligand, 4-1BBL, Cd137l, Cd157l, Homolog of mouse 4 1BB L, Homolog of mouse 4 1BBL, ILA ligand (TNF related), Ly63l, Receptor 4 1BB ligand, TNF superfamily member 9, TNFL9_HUMAN, Tnfsf9, TNLG5A, Tumor necrosis factor (ligand) superfamily member 9, Tumor necrosis factor ligand 5A, Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor superfamily member 9
Reference PX-P4060
Note For research use only
Molecular Constructor
Partial Yes
Product name Human TNFSF9-TNFSF4-1BBL recombinant protein
Uniprot ID P41273
Uniprot link http://www.uniprot.org/uniprot/P41273
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Molecular weight 22.64kDa
Protein delivered with Tag? Yes
Purity estimated 50%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms 4 1BB L, 4 1BB ligand, 4 1BBL, 4-1BB ligand, 4-1BBL, Cd137l, Cd157l, Homolog of mouse 4 1BB L, Homolog of mouse 4 1BBL, ILA ligand (TNF related), Ly63l, Receptor 4 1BB ligand, TNF superfamily member 9, TNFL9_HUMAN, Tnfsf9, TNLG5A, Tumor necrosis factor (ligand) superfamily member 9, Tumor necrosis factor ligand 5A, Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor superfamily member 9
Reference PX-P4060
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human TNFSF9-TNFSF4-1BBL recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products