Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oxelumab Biosimilar – Anti-TNFSF4, CD252 mAb – Research Grade

  • PX-TA1248-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade

Product name Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade
Uniprot ID P23510
Source CAS 1186098-83-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Oxelumab,R4930,RG4930,RO4989991,huMAb OX40L,TNFSF4, CD252,anti-TNFSF4, CD252
Reference PX-TA1248
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade
Uniprot ID P23510
Source CAS 1186098-83-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Oxelumab,R4930,RG4930,RO4989991,huMAb OX40L,TNFSF4, CD252,anti-TNFSF4, CD252
Reference PX-TA1248
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1248-50
Uniprot ID P23510
Source CAS 1186098-83-8
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Oxelumab,R4930,RG4930,RO4989991,huMAb OX40L,TNFSF4, CD252,anti-TNFSF4, CD252
Reference PX-TA1248
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-TNFSF4/CD252[Homo sapiens] (Oxelumab) Monoclonal Antibody

Oxelumab is investigated for the treatment of Mild Allergic Asthma.

SDS-PAGE for Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade

SDS-PAGE for Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade in WB Assay

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade in WB Assay

Oxelumab Biosimilar - Anti-CD252;TNFSF4;OX40L mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Oxelumab Biosimilar - Anti-TNFSF4, CD252 mAb - Research Grade

There are no reviews yet.

Be the first to review “Oxelumab Biosimilar – Anti-TNFSF4, CD252 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products