Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human CD40: Tumor necrosis factor receptor superfamily member 5(TNFRSF5) recombinant protein |
---|---|
Uniprot ID | P25942 |
Uniprot link | http://www.uniprot.org/uniprot/P25942 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | CREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGSHHHHHH |
Molecular weight | 19.68kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Cys26-Gly187 |
Aliases /Synonyms | CD40, CDW40, Bp50, P50, B-cell surface antigen CD40, CD40L receptor,TNFRSF5 |
Reference | PX-P4015 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.