Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein |
|---|---|
| Uniprot ID | P08887 |
| Uniprot link | http://www.uniprot.org/uniprot/P08887 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPGSHHHHHH |
| Molecular weight | 41.12kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD126, gp80, IL6R, IL-6R-1, IL-6R-Alpha, IL6RA, IL-6 receptor subunit alpha, Membrane glycoprotein 80 |
| Reference | PX-P4046 |
| Note | For research use only |
Description of Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein
General Information aboutHuman CD126/IL6R/Interleukin-6 receptor subunit alpha recombinant protein
A portion of the interleukin 6 receptor, which binds to IL6 with low affinity, but does not transmit signals (PubMed: 28265003). Signal activation must be related to IL6ST. Activation leads to immune response, acute phase response, and regulation of hematopoietic function (possibly). The interaction of membrane-bound IL6R and IL6ST stimulates “classical signaling” and the limited expression of IL6R limits classical IL6 signaling to only a few tissues, such as the liver and some cells of the immune system. In the process of binding of IL6R and soluble IL6R to IL6ST, “anti-signal transmission” is stimulated. Furthermore, when the membrane-bound IL6: IL6R complex on the transmitting cell activates the IL6ST receptor on the adjacent receptor, the “raster signal” will (possibly) occur
Related products
Biosimilar
Adalimumab Biosimilar – Anti-TNF alpha mAb – Research Grade
PX-TA1001 200€
Biosimilar
Infliximab Biosimilar – Anti-TNF-alpha mAb – Research Grade
PX-TA1009 200€
Biosimilar
Certolizumab Biosimilar – Anti-TNF-Alpha mAb – Research Grade
PX-TA1024 200€
Biosimilar
Olaratumab Biosimilar – Anti-PDGF-R alpha mAb – Research Grade
PX-TA1025 200€
Biosimilar
Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1088 200€
Biosimilar
Golimumab Biosimilar – Anti-TNFA, TNF alpha mAb – Research Grade
PX-TA1129 200€
Biosimilar
CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade
PX-TA1154 200€
Biosimilar
Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1219 200€
Biosimilar
Rontalizumab Biosimilar – Anti-IFNA1 mAb – Research Grade
PX-TA1235 200€
Biosimilar
Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1272 200€
Biosimilar
Placulumab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1302 200€
Biosimilar
Tosatoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade
PX-TA1324 200€
Biosimilar
Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade
PX-TA1362 200€
Biosimilar
Suvratoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade
PX-TA1460 200€
Ligand
Alpha-lactalbumin(LALBA)
PX-P4700 210€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.