Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tosatoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

  • PX-TA1324-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

Product name Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1374419-41-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tosatoxumab,KBSA301,alpha toxin,anti-alpha toxin
Reference PX-TA1324
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1374419-41-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tosatoxumab,KBSA301,alpha toxin,anti-alpha toxin
Reference PX-TA1324
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1324-50
Uniprot ID P09616
Source CAS 1374419-41-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tosatoxumab,KBSA301,alpha toxin,anti-alpha toxin
Reference PX-TA1324
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

General information on Anti-alpha toxin[Staphylococcus aureus] (Tosatoxumab) Monoclonal Antibody

Tosatoxumab is a human monoclonal antibody (IgG1 lambda) that targets the Staphylococcus aureus alpha-toxin or the S. aureus alpha-hemolysin thus protecting human cells.

SDS-PAGE for Tosatoxumab Biosimilar - Anti-alpha toxin mAb

SDS-PAGE for Tosatoxumab Biosimilar - Anti-alpha toxin mAb

Tosatoxumab Biosimilar - Anti-alpha toxin mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tosatoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

There are no reviews yet.

Be the first to review “Tosatoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products