Name: Alpha-lactalbumin(LALBA)
SKU: PX-P4700-10
Availability: InStock

Product name	Alpha-lactalbumin(LALBA)
Uniprot ID	P00709
Uniprot link	https://www.uniprot.org/uniprot/P00709
Expression system	Prokaryotic expression
Sequence	MKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLEHHHHHH
Molecular weight	15.1kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>80% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Lys20-Leu142
Protein Accession	P00709
Spec:Entrez GeneID	3906
Spec:NCBI Gene Aliases	LYZG
Spec:SwissProtID	Q6FGX0
NCBI Reference	P00709
Aliases /Synonyms	LYZL7，Lactose synthase B protein，Lysozyme-like protein 7
Reference	PX-P4700
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Alpha-lactalbumin(LALBA)”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.