Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Alpha-lactalbumin(LALBA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P00709
Molecular weight:
15.1kDa

€210.00

50ug + 210 loyalty points
Lys20–Leu142 His
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Alpha-lactalbumin(LALBA)

Alpha-lactalbumin(LALBA)

Product name Alpha-lactalbumin(LALBA)
Uniprot ID P00709
Uniprot link https://www.uniprot.org/uniprot/P00709
Expression system Prokaryotic expression
Sequence MKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLEHHHHHH
Molecular weight 15.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys20-Leu142
Protein Accession P00709
Spec:Entrez GeneID 3906
Spec:NCBI Gene Aliases LYZG
Spec:SwissProtID Q6FGX0
NCBI Reference P00709
Aliases /Synonyms LYZL7，Lactose synthase B protein，Lysozyme-like protein 7
Reference PX-P4700
Note For research use only
Molecular Constructor
Lys20–Leu142 His
Product name Alpha-lactalbumin(LALBA)
Uniprot ID P00709
Uniprot link https://www.uniprot.org/uniprot/P00709
Expression system Prokaryotic expression
Sequence MKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLEHHHHHH
Molecular weight 15.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys20-Leu142
Protein Accession P00709
Spec:Entrez GeneID 3906
Spec:NCBI Gene Aliases LYZG
Spec:SwissProtID Q6FGX0
NCBI Reference P00709
Aliases /Synonyms LYZL7，Lactose synthase B protein，Lysozyme-like protein 7
Reference PX-P4700
Note For research use only
Molecular Constructor
Lys20–Leu142 His

There are no reviews yet.

Be the first to review “Alpha-lactalbumin(LALBA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products