Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Suvratoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

  • PX-TA1460-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €171.00.Current price is: €140.00.

50ug 18% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

Product name Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1629620-18-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Suvratoxumab,MEDI4893,alpha toxin,anti-alpha toxin
Reference PX-TA1460
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1629620-18-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Suvratoxumab,MEDI4893,alpha toxin,anti-alpha toxin
Reference PX-TA1460
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1460-50
Uniprot ID P09616
Source CAS 1629620-18-3
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Suvratoxumab,MEDI4893,alpha toxin,anti-alpha toxin
Reference PX-TA1460
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Suvratoxumab Biosimilar, also known as Anti-alpha toxin mAb, is a monoclonal antibody that targets the alpha toxin produced by the bacterium Staphylococcus aureus. This biosimilar is a research grade antibody that has shown promising results in pre-clinical studies and has the potential to be developed as a therapeutic treatment for Staphylococcus aureus infections.

Structure of Suvratoxumab Biosimilar

Suvratoxumab Biosimilar is a recombinant humanized monoclonal antibody that is produced by genetic engineering techniques. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the alpha toxin, while the constant regions provide stability and effector functions.

The structure of Suvratoxumab Biosimilar is similar to that of the natural human antibody, making it less likely to cause an immune response in patients. This also allows for better targeting and binding to the alpha toxin, increasing the effectiveness of the antibody.

Activity of Suvratoxumab Biosimilar

Suvratoxumab Biosimilar works by binding to the alpha toxin produced by Staphylococcus aureus. This binding prevents the toxin from interacting with its target cells, thereby neutralizing its harmful effects. The antibody also triggers an immune response, leading to the destruction of the bacteria and clearance of the infection.

In addition to its neutralizing activity, Suvratoxumab Biosimilar also has effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These mechanisms further enhance the antibody’s ability to eliminate the bacteria and its toxin.

Application of Suvratoxumab Biosimilar

Suvratoxumab Biosimilar has potential applications in the treatment of Staphylococcus aureus infections. This bacterium is responsible for a wide range of diseases, from skin and soft tissue infections to life-threatening conditions such as pneumonia, sepsis, and endocarditis.

The use of Suvratoxumab Biosimilar as a therapeutic treatment can help in reducing the severity and duration of these infections. It can also prevent the development of antibiotic resistance, which is a major concern in the treatment of Staphylococcus aureus infections.

Skin and Soft Tissue Infections

Suvratoxumab Biosimilar can be used to treat skin and soft tissue infections caused by Staphylococcus aureus, such as impetigo, cellulitis, and abscesses. These infections are commonly treated with antibiotics, but with the increasing prevalence of antibiotic-resistant strains, the use of an alternative treatment like Suvratoxumab Biosimilar can be beneficial.

Pneumonia

Staphylococcus aureus is one of the leading causes of pneumonia, especially in hospitalized patients. Suvratoxumab Biosimilar can be used as an adjunct treatment to antibiotics in severe cases of pneumonia, as it can help in reducing the bacterial load and improving patient outcomes.

Sepsis and Endocarditis

Staphylococcus aureus infections can also lead to life-threatening conditions such as sepsis and endocarditis. Suvratoxumab Biosimilar can be used as a targeted therapy to neutralize the alpha toxin and prevent the progression of these infections.

Conclusion

In conclusion, Suvratoxumab Biosimilar is a promising antibody that targets the alpha toxin produced by Staphylococcus aureus. Its unique structure and activity make it an effective treatment option for a wide range of Staphylococcus aureus infections. Further clinical studies are needed to fully evaluate the efficacy and safety of this biosimilar, but it has the potential to be a valuable addition to the treatment of these infections.

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade in ELISA Assay

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade in ELISA Assay

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade

SDS-PAGE for Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

There are no reviews yet.

Be the first to review “Suvratoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products