Brand: ProteoGenix

CD58 Recombinant Protein

PX-P4086-100
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P19256
Molecular weight:: 40kDa

Original price was: €370.00.Current price is: €319.00.

100ug 14% OFF + 319 loyalty points

Met1~Arg215 His

Size Size

50ug Original price was: €254.00.Current price is: €223.00.
100ug Original price was: €370.00.Current price is: €319.00.
1MG Original price was: €1,036.00.Current price is: €925.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

CD58 Recombinant Protein

Product name	PX-P4086-100
Uniprot ID	P19256
Uniprot link	http://www.uniprot.org/uniprot/P19256
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight	40kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Arg215
Protein Accession	P19256
Spec:Entrez GeneID	965
Spec:NCBI Gene Aliases	ag3; LFA3; LFA-3
Spec:SwissProtID	Q5U053
NCBI Reference	P19256
Aliases /Synonyms	LFA3, Ag3
Reference	PX-P4086
Note	For research use only
Molecular Constructor	Met1~Arg215 His

Product name	PX-P4086-1MG
Uniprot ID	P19256
Uniprot link	http://www.uniprot.org/uniprot/P19256
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight	40kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Arg215
Protein Accession	P19256
Spec:Entrez GeneID	965
Spec:NCBI Gene Aliases	ag3; LFA3; LFA-3
Spec:SwissProtID	Q5U053
NCBI Reference	P19256
Aliases /Synonyms	LFA3, Ag3
Reference	PX-P4086
Note	For research use only
Molecular Constructor	Met1~Arg215 His

Product name	PX-P4086-50
Uniprot ID	P19256
Uniprot link	http://www.uniprot.org/uniprot/P19256
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight	40kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Arg215
Protein Accession	P19256
Spec:Entrez GeneID	965
Spec:NCBI Gene Aliases	ag3; LFA3; LFA-3
Spec:SwissProtID	Q5U053
NCBI Reference	P19256
Aliases /Synonyms	LFA3, Ag3
Reference	PX-P4086
Note	For research use only
Molecular Constructor	Met1~Arg215 His