Name: CD58 Recombinant Protein
SKU: PX-P4086-100
Price: 406.00 EUR
Availability: InStock

Product name	CD58 Recombinant Protein
Uniprot ID	P19256
Uniprot link	http://www.uniprot.org/uniprot/P19256
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Molecular weight	40kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	Store at - 20? to -80?. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1~Arg215
Protein Accession	P19256
Spec:Entrez GeneID	965
Spec:NCBI Gene Aliases	ag3; LFA3; LFA-3
Spec:SwissProtID	Q5U053
NCBI Reference	P19256
Aliases /Synonyms	LFA3, Ag3
Reference	PX-P4086
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “CD58 Recombinant Protein”

€406.00Available

Size

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Related products

Biosimilar Relatlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade PX-TA1496 400€

View product

Biosimilar Ieramilimab Biosimilar – Anti-LAG3 mAb – Research Grade PX-TA1562 400€

View product

Biosimilar Encelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade PX-TA1586 400€

View product

Biosimilar Fianlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade PX-TA1588 400€

View product

Biosimilar Mavezelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade PX-TA1595 400€

View product

Biosimilar Miptenalimab Biosimilar – Anti-LAG3 mAb – Research Grade PX-TA1686 400€

View product

Biosimilar Tebotelimab Biosimilar – Anti-PDCD1;LAG3 mAb – Research Grade PX-TA1722 400€

View product

Biosimilar Bavunalimab Biosimilar – Anti-LAG3;CTLA4 mAb – Research Grade PX-TA1813 400€

View product

Biosimilar Favezelimab Biosimilar – Anti-LAG3 mAb – Research Grade PX-TA1838 400€

View product

Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.