Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD40 Recombinant Protein |
|---|---|
| Uniprot ID | P25942 |
| Uniprot link | http://www.uniprot.org/uniprot/P25942 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Molecular weight | 22.32kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Arg193 |
| Aliases /Synonyms | TNFRSF5 |
| Reference | PX-P4082 |
| Note | For research use only |
CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily, which is a single transmembrane glycoprotein. The CD40 protein plays a vital role in mediating a variety of immune and inflammatory responses, including the change in class T that depends on the type of immunoglobulin, the development of B cell memory and the formation of reproductive centers. The CD40 protein is expressed in B cells, dendritic cells, macrophages, endothelial cells and some tumor cells. CD40 deficiency can lead to high IgM type 3 (HIGM3) immunodeficiency. In addition, β-amyloid-induced microglia activation requires CD40 / CD40L interaction and is therefore considered an early event in the pathogenesis of Alzheimer’s disease.
Immobilized CD40 Recombinant Protein (cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind to Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb (cat. No.PX-TA1503) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.