Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vascular endothelial growth factor A(VEGFA)

Host species:
Mammalian cells
Uniprot ID:
P15692-4
Molecular weight:
20.13kDa

210.00

50ug + 210 loyalty points
Met1–Arg191 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vascular endothelial growth factor A(VEGFA)

Product name Vascular endothelial Growth Factor proteins A(VEGFA)
Uniprot ID P15692-4
Uniprot link https://www.uniprot.org/uniprot/P15692#P15692-4
Expression system Eukaryotic expression
Raw Antigen Sequence MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 20.13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg191
Protein Accession P15692
Spec:Entrez GeneID 7422
Spec:NCBI Gene Aliases VPF; VEGF; MVCD1
Spec:SwissProtID Q074Z4
NCBI Reference P15692
Aliases /Synonyms VEGF,VPF
Reference PX-P4574
Note For research use only
Molecular Constructor
Met1–Arg191 His
Product name Vascular endothelial Growth Factor proteins A(VEGFA)
Uniprot ID P15692-4
Uniprot link https://www.uniprot.org/uniprot/P15692#P15692-4
Expression system Eukaryotic expression
Raw Antigen Sequence MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 20.13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg191
Protein Accession P15692
Spec:Entrez GeneID 7422
Spec:NCBI Gene Aliases VPF; VEGF; MVCD1
Spec:SwissProtID Q074Z4
NCBI Reference P15692
Aliases /Synonyms VEGF,VPF
Reference PX-P4574
Note For research use only
Molecular Constructor
Met1–Arg191 His

Vascular endothelial growth factor A(VEGFA)

There are no reviews yet.

Be the first to review “Vascular endothelial growth factor A(VEGFA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products