Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
scFv-kappa-heavy

Original price was: €174.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade

Product name Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1531589-13-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference PX-TA1374
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1531589-13-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference PX-TA1374
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name PX-TA1374-50
Uniprot ID P15692
Source CAS 1531589-13-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Brolucizumab,ESBA-1008,ESBA1008,RTH258,VEGFA,anti-VEGFA
Reference PX-TA1374
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody

General information on Anti-VEGFA[Homo sapiens] (Brolucizumab) Monoclonal Antibody

Brolucizumab is a monoclonal antibody used to treat neovascular age related macular degeneration.

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

SDS-PAGE for Brolucizumab Biosimilar - Anti-VEGFA mAb

Brolucizumab Biosimilar - Anti-VEGFA mAb, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.

Brolucizumab Biosimilar - Anti-VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Brolucizumab Biosimilar – Anti-VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products