Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vanucizumab Biosimilar – Anti-ANGPT2, VEGFA, mAb – Research Grade

  • PX-TA1355-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa

Original price was: €179.00.Current price is: €140.00.

50ug 22% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb - Research Grade

Product name Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1448221-05-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vanucizumab,RG-7221,RG7221,RO5520985,ANGPT2, VEGFA, ,anti-ANGPT2, VEGFA,
Reference PX-TA1355
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa
Clonality Monoclonal Antibody
Product name Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1448221-05-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vanucizumab,RG-7221,RG7221,RO5520985,ANGPT2, VEGFA, ,anti-ANGPT2, VEGFA,
Reference PX-TA1355
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa
Clonality Monoclonal Antibody
Product name PX-TA1355-50
Uniprot ID P15692 & O15123
Source CAS 1448221-05-3
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vanucizumab,RG-7221,RG7221,RO5520985,ANGPT2, VEGFA, ,anti-ANGPT2, VEGFA,
Reference PX-TA1355
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-C-kappa-CH2-CH3_V-lambda-CH1_H-GAMMA-1_L-kappa
Clonality Monoclonal Antibody

General information on Anti-ANGPT2/VEGFA[Homo sapiens], (Vanucizumab) Monoclonal Antibody

Vanucizumab has been investigated for the treatment of Colorectal Cancer and Advanced/Metastatic Solid Tumors.

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb (cat. No.PX-TA1355) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 105.6M.

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA,  mAb - Research Grade

There are no reviews yet.

Be the first to review “Vanucizumab Biosimilar – Anti-ANGPT2, VEGFA, mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products