Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Faricimab Biosimilar – Anti-ANGPT2, VEGFA mAb – Research Grade

  • PX-TA1501-100UG
  • Validated ELISA
Isotype:
IgG1 Kappa, IgG1 Lambda

Original price was: €242.00.Current price is: €200.00.

100ug 17% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade

Product name Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1607793-29-2
Species Humanized
Expression system Mammalian
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Faricimab,RG7716,RO6867461,ANGPT2, VEGFA,anti-ANGPT2, VEGFA
Reference PX-TA1501
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa-lambda
Clonality Monoclonal Antibody
Product name Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade
Uniprot ID P15692 & O15123
Source CAS 1607793-29-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Faricimab,RG7716,RO6867461,ANGPT2, VEGFA,anti-ANGPT2, VEGFA
Reference PX-TA1501
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa-lambda
Clonality Monoclonal Antibody
Product name PX-TA1501-50
Uniprot ID P15692 & O15123
Source CAS 1607793-29-2
Species Humanized
Expression system Mammalian
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Faricimab,RG7716,RO6867461,ANGPT2, VEGFA,anti-ANGPT2, VEGFA
Reference PX-TA1501
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa, IgG1 Lambda

About Faricimab biosimilar

Faricimab is a bispecific monoclonal antibody. This antibody is especially part of the human immunoglobulin G1-kappa-lambda type. It is targeting angiopoetin 2 (ANGPT2) and Vascular Endothelial Growth factor A (VEGFA). Both of these factors play key roles in angiogenesis and endothelial development respectively. Angiopoetin 2 is essential for normal vascular development as VEGF-A, which is an endothelial cell mitogen. Angiopoetin 2 is involved especially in vascular morphogenesis and homeostasis, and is mostly expressed in endothelial cells.
The expression of VEGF-A is shown to be up regulated in inflamed and vascularized human corneas. VEGF-A is therefore a target of choice to treat patients with retinal vascular diseases such as a retinal vein occlusion, Age related macular degeneration (AMD) and diabetic macular edema. Indeed, these diseases are caused by retinal ischemia and subsequent neovascularization.

A research grade biosimilar

Faricimab biosimilar is a humanized antibody based on on cross Mab technology. It is produced in mammalian cell line (Chinese Hamster Ovary -CHO) using a recombinant DNA technology. Proteogenix offer a product for research use only, not suitable for clinical or therapeutic use.

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb binds to Human ANGPT2 in indirect ELISA Assay

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb binds to Human ANGPT2 in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb (cat. No.PX-TA1501) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 66.43M.

SDS-PAGE for Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb

SDS-PAGE for Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb, on SDS-PAGE under non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Faricimab Biosimilar – Anti-ANGPT2, VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products