Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Varisacumab Biosimilar – Anti-VEGFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €192.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

Product name Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1610010-60-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Varisacumab,AT-001,GNR-011,r84,VEGFA,anti-VEGFA
Reference PX-TA1458
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS 1610010-60-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Varisacumab,AT-001,GNR-011,r84,VEGFA,anti-VEGFA
Reference PX-TA1458
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1458-50
Uniprot ID P15692
Source CAS 1610010-60-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Varisacumab,AT-001,GNR-011,r84,VEGFA,anti-VEGFA
Reference PX-TA1458
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Varisacumab Biosimilar: A Potent Anti-VEGFA mAb for

Cancer Treatment Introduction

Varisacumab Biosimilar is a monoclonal antibody (mAb) that specifically targets vascular endothelial growth factor A (VEGFA), a key protein involved in angiogenesis and tumor growth. This biosimilar has been developed as a research grade therapeutic agent for the treatment of various types of cancer.

Structure of Varisacumab Biosimilar

Varisacumab Biosimilar is a recombinant humanized IgG1 mAb, with a molecular weight of approximately 150 kDa. It is produced by recombinant DNA technology in mammalian cell culture, ensuring high purity and stability. The antibody consists of two heavy chains and two light chains, connected by disulfide bonds. It has a unique amino acid sequence that specifically binds to VEGFA with high affinity and specificity.

Mechanism of Action

Varisacumab Biosimilar works by binding to VEGFA and preventing its interaction with its receptors, VEGFR1 and VEGFR2. This inhibits the downstream signaling pathway, leading to reduced angiogenesis and tumor growth. Additionally, the bound antibody can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against VEGFA-expressing tumor cells, further enhancing its anti-tumor activity.

Applications of Varisacumab Biosimilar

Varisacumab Biosimilar has shown promising results in pre-clinical and clinical studies as a potential therapeutic agent for various types of cancer. It has been evaluated in breast, lung, colorectal, and ovarian cancer models, and has demonstrated significant anti-tumor activity. In addition, this biosimilar has also shown potential as a combination therapy with other anti- cancer agents, such as chemotherapy and immune checkpoint inhibitors.

Advantages of Varisacumab Biosimilar

Compared to other anti-VEGFA mAbs, Varisacumab Biosimilar has several advantages. Firstly, its humanized structure reduces the risk of immune reactions and increases its half-life in the body. Secondly, its high specificity for VEGFA minimizes the potential for off-target effects. Thirdly, its potent anti-tumor activity has been demonstrated in various cancer models, making it a promising candidate for cancer treatment.

Conclusion

Varisacumab Biosimilar is a novel and promising therapeutic agent for the treatment of cancer. Its unique structure and mechanism of action make it a potent anti-VEGFA mAb, with high specificity and efficacy. Further research and clinical trials are needed to fully evaluate its potential as a cancer therapy, but it holds great promise for improving the treatment of various types of cancer.

Keywords: Varisacumab Biosimilar, monoclonal antibody, VEGFA, angiogenesis, tumor growth, cancer treatment, anti-tumor activity, humanized, specificity.

SDS-PAGE for Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

SDS-PAGE for Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Varisacumab Biosimilar - Anti-VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Varisacumab Biosimilar – Anti-VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products