Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tarcocimab Biosimilar – Anti-VEGFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €357.00.Current price is: €259.00.

50ug 27% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

Product name Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS: 2408661-40-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tarcocimab,OG1953,VEGFA,anti-VEGFA
Reference PX-TA1780
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade
Uniprot ID P15692
Source CAS: 2408661-40-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tarcocimab,OG1953,VEGFA,anti-VEGFA
Reference PX-TA1780
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1780-50
Uniprot ID P15692
Source CAS: 2408661-40-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tarcocimab,OG1953,VEGFA,anti-VEGFA
Reference PX-TA1780
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Tarcocimab Biosimilar, also known as Anti-VEGFA mAb, is a monoclonal antibody that specifically targets the vascular endothelial growth factor A (VEGFA). This biosimilar is a research-grade version of the original Tarcocimab, which is a therapeutic antibody used in the treatment of various diseases. In this article, we will discuss the structure, activity, and potential applications of Tarcocimab Biosimilar.

Structure

Tarcocimab Biosimilar is a humanized monoclonal antibody, meaning it is derived from both human and non-human sources. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab region is responsible for binding to the VEGFA molecule, while the Fc region plays a role in immune effector functions.

Activity

The main function of Tarcocimab Biosimilar is to inhibit the activity of VEGFA. VEGFA is a key factor in the formation of new blood vessels, a process known as angiogenesis. In certain diseases, such as cancer and age-related macular degeneration, VEGFA is overexpressed, leading to excessive angiogenesis. This can result in tumor growth and abnormal blood vessel formation in the eye, leading to vision loss. By binding to VEGFA, Tarcocimab Biosimilar prevents it from interacting with its receptors, thereby reducing angiogenesis and inhibiting disease progression.

Tarcocimab Biosimilar also has immunomodulatory effects. It can bind to Fc receptors on immune cells, such as natural killer cells and macrophages, and activate them to destroy cancer cells. This mechanism, known as antibody-dependent cellular cytotoxicity (ADCC), enhances the therapeutic effect of Tarcocimab Biosimilar in cancer treatment.

Applications

Tarcocimab Biosimilar has potential applications in various diseases, particularly those involving excessive angiogenesis. In oncology, it can be used as a monotherapy or in combination with other anticancer agents to treat solid tumors, such as breast, lung, and colon cancer. It has shown promising results in clinical trials, with some patients achieving complete remission.

In ophthalmology, Tarcocimab Biosimilar can be used to treat age-related macular degeneration, a leading cause of blindness in the elderly. By inhibiting VEGFA, it can prevent the growth of abnormal blood vessels in the retina, preserving vision.

Tarcocimab Biosimilar may also have potential in other diseases, such as diabetic retinopathy, psoriasis, and rheumatoid arthritis, where angiogenesis plays a role in disease progression. Further research is needed to fully explore its therapeutic potential in these conditions.

Conclusion

Tarcocimab Biosimilar is a promising research-grade monoclonal antibody that specifically targets VEGFA. Its structure and activity make it an effective inhibitor of angiogenesis, with potential applications in various diseases. As more studies are conducted, Tarcocimab Biosimilar may become a valuable therapeutic option for patients in need of VEGFA inhibition.

SDS-PAGE for Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

SDS-PAGE for Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade , on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tarcocimab Biosimilar - Anti-VEGFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Tarcocimab Biosimilar – Anti-VEGFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products