Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Secukinumab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1234-100UG
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: €148.00.Current price is: €120.00.

100ug 19% OFF + 120 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1234-50
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1229022-83-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Secukinumab,AIN457,IL17A,anti-IL17A
Reference PX-TA1234
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

Introduction

Secukinumab Biosimilar is a monoclonal antibody (mAb) that targets the cytokine interleukin-17A (IL-17A). It is a research grade antibody that has shown promising results in preclinical studies and is currently being investigated for its potential therapeutic applications.

Structure of Secukinumab Biosimilar

Secukinumab Biosimilar is a humanized IgG1κ mAb that is produced using recombinant DNA technology. It has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of constant and variable regions, while the light chains only have variable regions. The variable regions of the antibody are responsible for binding to the target cytokine, IL-17A.

Mechanism of Action

IL-17A is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases. Secukinumab Biosimilar binds to IL-17A with high affinity, preventing it from binding to its receptor and exerting its pro-inflammatory effects. This leads to a reduction in the production of other pro-inflammatory cytokines and chemokines, ultimately resulting in the suppression of inflammation.

Therapeutic Target

The therapeutic target of Secukinumab Biosimilar is IL-17A, which is a key mediator of inflammation in various diseases. IL-17A is produced by a subset of T helper cells, known as Th17 cells, and has been implicated in the pathogenesis of diseases such as psoriasis, psoriatic arthritis, ankylosing spondylitis, and rheumatoid arthritis. By targeting IL-17A, Secukinumab Biosimilar has the potential to provide relief to patients suffering from these diseases.

Application of Secukinumab Biosimilar

Secukinumab Biosimilar is being investigated for its potential therapeutic applications in various autoimmune and inflammatory diseases. Clinical trials have shown promising results in the treatment of psoriasis, psoriatic arthritis, and ankylosing spondylitis. It has also shown potential in the treatment of rheumatoid arthritis, with ongoing clinical trials evaluating its efficacy and safety in this disease. Additionally, preclinical studies have shown that Secukinumab Biosimilar may also have a role in the treatment of other IL-17A-mediated diseases such as inflammatory bowel disease and multiple sclerosis.

Conclusion

In conclusion, Secukinumab Biosimilar is a monoclonal antibody that targets the cytokine IL-17A and has shown promising results in preclinical and clinical studies. Its ability to inhibit IL-17A and suppress inflammation makes it a potential therapeutic option for various autoimmune and inflammatory diseases. Further research and clinical trials are needed to fully understand the efficacy and safety of Secukinumab Biosimilar in different diseases, but it holds great promise as a potential treatment option for patients in need.

SDS-PAGE for Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

SDS-PAGE for Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Secukinumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1234) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Secukinumab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Secukinumab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products