Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Afasevikumab Biosimilar – Anti-IL17A , IL17F mAb – Research Grade

  • PX-TA1401-100UG
  • Validated FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €270.00.Current price is: €200.00.

100ug 26% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade

Product name Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1589503-30-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Afasevikumab,MCAF-5352A,NI-1401,RG-7624,RO5553110,IL17A , IL17F,anti-IL17A , IL17F
Reference PX-TA1401
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1589503-30-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Afasevikumab,MCAF-5352A,NI-1401,RG-7624,RO5553110,IL17A , IL17F,anti-IL17A , IL17F
Reference PX-TA1401
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1401-50
Uniprot ID Q16552 & Q96PD4
Source CAS 1589503-30-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Afasevikumab,MCAF-5352A,NI-1401,RG-7624,RO5553110,IL17A , IL17F,anti-IL17A , IL17F
Reference PX-TA1401
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL17A /IL17F[Homo sapiens] (Afasevikumab) Monoclonal Antibody

Afasevikumab is a monoclonal antibody that targets IL17 and is investigated for the treatment of Multiple Sclerosis(MS).

SDS-PAGE for Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb

SDS-PAGE for Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb

Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade

There are no reviews yet.

Be the first to review “Afasevikumab Biosimilar – Anti-IL17A , IL17F mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products