Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ixekizumab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1022-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source DrugBank DB11569
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 146kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ixekizumab,Ixekizumab,IL17A,anti-IL17A
Reference PX-TA1022
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4Kappa
Clonality Monoclonal Antibody
Product name Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source DrugBank DB11569
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 146kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ixekizumab,Ixekizumab,IL17A,anti-IL17A
Reference PX-TA1022
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4Kappa
Clonality Monoclonal Antibody
Product name PX-TA1022-50
Uniprot ID Q16552
Source DrugBank DB11569
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 146kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ixekizumab,Ixekizumab,IL17A,anti-IL17A
Reference PX-TA1022
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information about Ixekizumab

Recombinant monoclonal antibody to IL17A. Ixekizumab is a humanized monoclonal antibody used in the treatment of autoimmune diseases. This product is for research use only.

SDS-PAGE for Ixekizumab Biosimilar - Anti-IL17A mAb

SDS-PAGE for Ixekizumab Biosimilar - Anti-IL17A mAb

Ixekizumab Biosimilar - Anti-IL17A mAb on SDS-PAGE under reducing (left figure) and non-reducing (right figure) conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is superior than 90 %.

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Ixekizumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1022) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Flow Cytometry results for Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

Flow Cytometry results for Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

Flow-cytometry using anti-human IL17A antibody. Jurkat cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an anti-human IL17A monoclonal antibody (Catalog PX-TA1022, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SEC-HPLC of Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

SEC-HPLC of Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade was analyzed by size exclusion chromatography with UV detection.

Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to Recombinant Mouse IL17A Protein, N-His in WB Assay

Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to Recombinant Mouse IL17A Protein, N-His in WB Assay

Recombinant Mouse IL17A Protein, N-His(cat. No.ARO-P12452) can bind Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade in Western Blot Assay as detected on gel analysis.

Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Ixekizumab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products