Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bimekizumab Biosimilar – Anti-IL17A, IL17F mAb – Research Grade

  • PX-TA1342-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €183.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

Product name Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1418205-77-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Bimekizumab,CDP4940,IL17A, IL17F,anti-IL17A, IL17F
Reference PX-TA1342
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1418205-77-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Bimekizumab,CDP4940,IL17A, IL17F,anti-IL17A, IL17F
Reference PX-TA1342
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1342-50
Uniprot ID Q16552 & Q96PD4
Source CAS 1418205-77-2
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Bimekizumab,CDP4940,IL17A, IL17F,anti-IL17A, IL17F
Reference PX-TA1342
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL17A[Homo sapiens] (Bimekizumab) Monoclonal Antibody

Bimekizumab has beeninvestigated for the treatment of Psoriatic arthritis, Ankylosing Spondylitis, Chronic Plaque Psoriasis, and Mild to Moderate Psoriasis.

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb (cat. No.PX-TA1342) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Flow Cytometry results for Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

Flow Cytometry results for Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

SDS-PAGE for Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb - Research Grade

There are no reviews yet.

Be the first to review “Bimekizumab Biosimilar – Anti-IL17A, IL17F mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products