Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Netakimab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1499-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Netakimab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1796570-08-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Netakimab,AG1-25,IL17A,anti-IL17A
Reference PX-TA1499
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Netakimab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1796570-08-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Netakimab,AG1-25,IL17A,anti-IL17A
Reference PX-TA1499
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1499-50
Uniprot ID Q16552
Source CAS 1796570-08-5
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Netakimab,AG1-25,IL17A,anti-IL17A
Reference PX-TA1499
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

The Structure of Netakimab Biosimilar

Netakimab Biosimilar, also known as Anti-IL17A mAb, is a monoclonal antibody that targets the cytokine Interleukin 17A (IL-17A). It is a biosimilar version of the original Netakimab, which is a humanized IgG1 antibody. The structure of Netakimab Biosimilar is similar to that of the original antibody, with some minor differences in the amino acid sequence.

The antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains have a molecular weight of approximately 50 kDa, while the light chains have a molecular weight of approximately 25 kDa. The antibody has a total molecular weight of approximately 150 kDa.

The Activity of Netakimab Biosimilar

Netakimab Biosimilar works by binding to IL-17A, a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases. IL-17A is produced by a subset of T cells known as Th17 cells, and it acts on various cell types, including epithelial cells, fibroblasts, and macrophages, to induce the production of pro-inflammatory cytokines, chemokines, and other mediators.

By binding to IL-17A, Netakimab Biosimilar prevents its interaction with its receptor, IL-17RA, and thus inhibits the downstream signaling pathways that lead to inflammation. This results in a decrease in the production of pro-inflammatory cytokines and chemokines, leading to a reduction in inflammation and associated symptoms.

The Application of Netakimab Biosimilar

Netakimab Biosimilar is primarily used as a therapeutic agent for the treatment of autoimmune and inflammatory diseases. It has been approved for the treatment of psoriasis, psoriatic arthritis, and ankylosing spondylitis in various countries, including Russia, India, and Brazil.

Psoriasis is a chronic autoimmune skin disorder characterized by red, scaly patches on the skin. It is caused by an overactive immune response, and IL-17A is one of the key cytokines involved in the pathogenesis of this disease. By targeting IL-17A, Netakimab Biosimilar can effectively reduce inflammation and improve symptoms in patients with psoriasis.

Psoriatic arthritis is a type of arthritis that affects some people with psoriasis. It is characterized by joint pain, swelling, and stiffness, and it can lead to permanent joint damage if left untreated. Netakimab Biosimilar has been shown to be effective in reducing the symptoms of psoriatic arthritis and improving the quality of life of patients.

Ankylosing spondylitis is a type of inflammatory arthritis that primarily affects the spine. It is characterized by pain and stiffness in the lower back, and it can also affect other joints, such as the hips and shoulders. Netakimab Biosimilar has been approved for the treatment of ankylosing spondylitis in Russia, and it has shown promising results in reducing inflammation and improving symptoms in patients.

In addition to these approved indications, Netakimab Biosimilar is also being studied for its potential use in other autoimmune and inflammatory diseases, such as rheumatoid arthritis, inflammatory bowel disease, and multiple sclerosis. Its ability to target IL-17A makes it a promising therapeutic agent for these conditions, and further research is needed to determine its efficacy and safety.

In Conclusion

Netakimab Biosimilar, also known as Anti-IL17A mAb, is a monoclonal antibody that targets the pro-inflammatory cytokine IL-17A. It works by binding to IL-17A and inhibiting its interaction with its receptor, leading to a decrease in inflammation and associated symptoms. It is primarily used for the treatment of psoriasis, psoriatic arthritis, and ankylosing spondylitis, and it has shown promising results in clinical trials. Further research is needed to explore its potential use in other autoimmune and

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Netakimab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1499) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1.931M.

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Netakimab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products