Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ixekizumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ixekizumab ELISA Kit

Ixekizumab ELISA Kit

Product name Ixekizumab ELISA Kit
Uniprot ID Q16552
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX259
Note For research use only.
Sample type Plasma, Serum
Target Ixekizumab
Immunogen Ixekizumab

The Structure of Ixekizumab ELISA Kit

Ixekizumab ELISA Kit is a highly sensitive and specific assay designed for the quantitative measurement of Ixekizumab in various biological samples. Ixekizumab is a humanized monoclonal antibody that specifically targets interleukin-17A (IL-17A), a pro-inflammatory cytokine involved in the pathogenesis of various autoimmune diseases. The structure of Ixekizumab ELISA Kit is based on the principle of enzyme-linked immunosorbent assay (ELISA), which utilizes the specific binding of antibodies to their target antigen for detection and quantification.

The kit consists of pre-coated microplates, which are coated with a monoclonal antibody specific for Ixekizumab. The samples, along with standards and controls, are added to the wells of the microplate and allowed to bind to the immobilized antibody. After washing away any unbound material, a biotinylated detection antibody is added, followed by a streptavidin-horseradish peroxidase (HRP) conjugate. The HRP enzyme catalyzes the conversion of a colorless substrate to a colored product, which is directly proportional to the amount of Ixekizumab present in the sample. The color intensity is measured using a microplate reader at a wavelength of 450 nm.

The Activity of Ixekizumab ELISA Kit

Ixekizumab ELISA Kit has a high sensitivity and specificity, with a lower limit of detection (LOD) of 0.1 ng/mL and a lower limit of quantification (LOQ) of 0.5 ng/mL. This means that the kit can accurately detect and quantify very low levels of Ixekizumab in biological samples, making it suitable for use in clinical and research settings.

The activity of Ixekizumab ELISA Kit is based on the specific binding of the monoclonal antibodies to Ixekizumab. The kit has been validated for use in various biological samples, including serum, plasma, and cell culture supernatants. It has also been shown to have minimal cross-reactivity with other related proteins, ensuring the accuracy and specificity of the results.

The Application of Ixekizumab ELISA Kit

Ixekizumab ELISA Kit has a wide range of applications, particularly in the field of autoimmune diseases. Ixekizumab is currently approved for the treatment of moderate to severe plaque psoriasis, psoriatic arthritis, and ankylosing spondylitis. The kit can be used to monitor the levels of Ixekizumab in patients undergoing treatment, allowing for personalized dosing and optimization of therapy.

In addition, Ixekizumab ELISA Kit can also be used in research studies to investigate the role of IL-17A in various autoimmune diseases. It can be used to measure the levels of Ixekizumab in animal models and in vitro studies, providing valuable insights into the pharmacokinetics and pharmacodynamics of the drug.

Furthermore, Ixekizumab ELISA Kit can also be used in the development and production of Ixekizumab biosimilars. Biosimilars are biological products that are highly similar to an approved reference product, and the kit can be used to ensure the quality and consistency of these products.

In conclusion, Ixekizumab ELISA Kit is a highly sensitive and specific assay that plays a crucial role in the detection, quantification, and monitoring of Ixekizumab in various biological samples. Its wide range of applications makes it a valuable tool for both clinical and research purposes, contributing to the advancement of autoimmune disease treatment and understanding.

Ixekizumab ELISA Kit

There are no reviews yet.

Be the first to review “Ixekizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products