Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vunakizumab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1444-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1792181-33-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vunakizumab,SHR-1314,IL17A,anti-IL17A
Reference PX-TA1444
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1792181-33-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vunakizumab,SHR-1314,IL17A,anti-IL17A
Reference PX-TA1444
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1444-50
Uniprot ID Q16552
Source CAS 1792181-33-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vunakizumab,SHR-1314,IL17A,anti-IL17A
Reference PX-TA1444
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Vunakizumab Biosimilar – Anti-IL17A mAb

Vunakizumab Biosimilar – Anti-IL17A mAb is a research grade monoclonal antibody (mAb) that targets the cytokine interleukin-17A (IL-17A). This biosimilar is designed to mimic the structure and function of the original Vunakizumab, a fully human mAb developed by Merck for the treatment of autoimmune diseases. In this article, we will delve into the structure, activity, and potential applications of this promising biosimilar.

Structure of Vunakizumab Biosimilar – Anti-IL17A mAb

Vunakizumab Biosimilar – Anti-IL17A mAb is a recombinant, humanized mAb that is produced in a mammalian cell expression system. It consists of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL and CL’) and one variable domain (VL). The VH and VL domains come together to form the antigen-binding site, which is responsible for the specificity of the mAb.

Activity of Vunakizumab Biosimilar – Anti-IL17A mAb

IL-17A is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of autoimmune diseases such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. Vunakizumab Biosimilar – Anti-IL17A mAb binds specifically to IL-17A, preventing it from binding to its receptor and thereby inhibiting its activity. This leads to a decrease in the production of other pro-inflammatory cytokines and chemokines, ultimately reducing inflammation and tissue damage.

Applications of Vunakizumab Biosimilar – Anti-IL17A mAb

Due to its ability to target IL-17A, Vunakizumab Biosimilar – Anti-IL17A mAb has potential applications in the treatment of various autoimmune diseases. It has been shown to be effective in clinical trials for psoriasis, with a significant reduction in disease severity and improvement in symptoms. In addition, it has also shown promising results in clinical trials for rheumatoid arthritis and ankylosing spondylitis.

Furthermore, Vunakizumab Biosimilar – Anti-IL17A mAb has been investigated for its potential in treating other autoimmune diseases such as psoriatic arthritis, Crohn’s disease, and ulcerative colitis. These diseases share a common pathogenesis involving IL-17A, making Vunakizumab Biosimilar – Anti-IL17A mAb a promising therapeutic option.

Conclusion

In summary, Vunakizumab Biosimilar – Anti-IL17A mAb is a research grade mAb that targets IL-17A, a key cytokine involved in the pathogenesis of various autoimmune diseases. Its structure and activity make it a promising therapeutic option for conditions such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. With ongoing research and clinical trials, Vunakizumab Biosimilar – Anti-IL17A mAb has the potential to provide new treatment options for patients suffering from these debilitating diseases.

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1444) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.347M.

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Vunakizumab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products