Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human VEGF Recombinant Protein |
|---|---|
| Uniprot ID | P15692 |
| Uniprot link | http://www.uniprot.org/uniprot/P15692 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLDDDDKAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR |
| Molecular weight | 14,65 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Buffer | PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AAH65522.2 |
| Spec:Entrez GeneID | 7422 |
| Spec:NCBI Gene Aliases | MVCD1, VPF, VEGF |
| Spec:SwissProtID | P15692 |
| NCBI Reference | AAH65522.2 |
| Aliases /Synonyms | VEGF, VEGFA protein, Vascular endothelial Growth Factor proteins A, VEGF-A, Vascular permeability factor, VPF, VEGFA |
| Reference | PX-P1060 |
| Note | For research use only. |
Human VEGF Recombinant Protein, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.