Brand: ProteoGenix

Aflibercept Biosimilar – Anti-VEGF mAb – Research Grade

PX-TA1016-50
Validated ELISA FC

Clonality:: Monoclonal Antibody
Isotype:: hG1-Fc

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points

Size Size

50ug Original price was: €185.00.Current price is: €140.00.
100ug Original price was: €246.00.Current price is: €200.00.
1MG Original price was: €486.00.Current price is: €405.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Aflibercept Biosimilar - Anti-VEGF mAb

Aflibercept Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

SEC-HPLC of Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade

Flow Cytometry results for Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade

Datasheet

Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade

Product name	PX-TA1016-50
Uniprot ID	P15692
Source	DrugBank DB08885
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	115kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Aliases /Synonyms	Aflibercept,Aflibercept,VEGF,anti-VEGF
Reference	PX-TA1016
Note	For research use only. Not suitable for human use.
Isotype	hG1-Fc
Clonality	Monoclonal Antibody

Product name	Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID	P15692
Source	DrugBank DB08885
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	115kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Aflibercept,Aflibercept,VEGF,anti-VEGF
Reference	PX-TA1016
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	hG1-Fc
Clonality	Monoclonal Antibody

Product name	Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID	P15692
Source	DrugBank DB08885
Species	Human
Expression system	Mammalian cells
Raw Antigen Sequence	MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight	115kDa
Purity	>85%
Buffer	PBS pH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term; -20°C for long term
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Aflibercept,Aflibercept,VEGF,anti-VEGF
Reference	PX-TA1016
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	hG1-Fc
Clonality	Monoclonal Antibody

General information about Aflibercept

Aflibercept is a recombinant protein composed of the binding domains of two human vascular endothelial growth factor (VEGF) receptors fused with the Fc region of human immunoglobulin gamma 1 (IgG1). Structurally, Aflibercept is a dimeric glycoprotein with a protein molecular weight of 96.9 kilo Daltons (kDa). It contains approximately 15% glycosylation to give a total molecular weight of 115 kDa. All five putative N-glycosylation sites on each polypeptide chain predicted by the primary sequence can be occupied with carbohydrate and exhibit some degree of chain heterogeneity, including heterogeneity in terminal sialic acid residues, except at the single unsialylated site associated with the Fc domain. Aflibercept, as an ophthalmic agent, is used in the treatment of macular edema following Central Retinal Vein Occlusion (CRVO) and neovascular Age-Related Macular Degeneration (AMD). Ziv-aflibercept, under the brand name Zaltrap, was developed as an injection for treatment of metastatic colorectal cancer. This product is for research use only.

Datasheet

SDS-PAGE for Aflibercept Biosimilar - Anti-VEGF mAb

Aflibercept Biosimilar - Anti-VEGF mAb, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Aflibercept Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind Aflibercept Biosimilar - Anti-VEGF mAb (cat. No.PX-TA1016) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 0.52M.

SEC-HPLC of Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade

Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade was analyzed by size exclusion chromatography with UV detection.

Flow Cytometry results for Aflibercept Biosimilar - Anti-VEGF mAb - Research Grade

Flow-cytometry using FITC anti-human VEGFA antibody. U87 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human VEGFA monoclonal antibody (Catalog: PX-TA1016, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.