Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human VEGF Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P15692
Molecular weight:
14,65 kDa

210.00

50ug + 210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human VEGF Recombinant Protein

Product name Human VEGF Recombinant Protein
Uniprot ID P15692
Uniprot link http://www.uniprot.org/uniprot/P15692
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLDDDDKAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDE GLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR
Molecular weight 14,65 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH65522.2
Spec:Entrez GeneID 7422
Spec:NCBI Gene Aliases MVCD1, VPF, VEGF
Spec:SwissProtID P15692
NCBI Reference AAH65522.2
Aliases /Synonyms VEGF, VEGFA protein, Vascular endothelial Growth Factor proteins A, VEGF-A, Vascular permeability factor, VPF, VEGFA
Reference PX-P1060
Note For research use only
Molecular Constructor
Partial Yes
Product name Human VEGF Recombinant Protein
Uniprot ID P15692
Uniprot link http://www.uniprot.org/uniprot/P15692
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLDDDDKAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDE GLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR
Molecular weight 14,65 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAH65522.2
Spec:Entrez GeneID 7422
Spec:NCBI Gene Aliases MVCD1, VPF, VEGF
Spec:SwissProtID P15692
NCBI Reference AAH65522.2
Aliases /Synonyms VEGF, VEGFA protein, Vascular endothelial Growth Factor proteins A, VEGF-A, Vascular permeability factor, VPF, VEGFA
Reference PX-P1060
Note For research use only
Molecular Constructor
Partial Yes

SDS-PAGE for Human VEGF Recombinant Protein

SDS-PAGE for Human VEGF Recombinant Protein

Human VEGF Recombinant Protein, on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

  • Burmeister K, Quagliata L, Andreozzi M, Eppenberger-Castori S, Matter MS, Perrina V, Grobholz R, Jochum W, Horber D, Moosmann P, Lehmann F, Köberle D, Ng CK, Piscuoglio S, Tornillo L, Terracciano LM. Vascular endothelial Growth Factor proteins A amplification in colorectal cancer is associated with reduced M1 and M2 macrophages and diminished PD-1-expressing lymphocytes. PLoS One. 2017 Apr 12;12(4):e0175563. doi: 10.1371/journal.pone.0175563. eCollection 2017. PubMed PMID: 28403223; PubMed Central PMCID: PMC5389821.
  • Yin J, Shen L, Ji M, Wu Y, Cai S, Chen J, Yao Z, Ge J. Inverse Relationship between Serum VEGF Levels and Late In-Stent Restenosis of Drug-Eluting Stents. Biomed Res Int. 2017;2017:8730271. doi: 10.1155/2017/8730271. Epub 2017 Mar 8. PubMed PMID: 28373989; PubMed Central PMCID: PMC5360953.
  • Ruffolo C, Toffolatti L, Canal F, Kotsafti A, Pagura G, Pozza A, Campo Dell'Orto M, Ferrara F, Massani M, Dei Tos AP, Castoro C, Bassi N, Scarpa M. Colorectal polypoid lesions and expression of vascular endothelial Growth Factor proteins in a consecutive series of endoscopic and surgical patients. Tumour Biol. 2017 Mar;39(3):1010428317692263. doi: 10.1177/1010428317692263. PubMed PMID: 28347226.
  • Naykoo NA, Dil-Afroze, Rasool R, Shah S, Ahangar AG, Bhat IA, Qasim I, Siddiqi MA, Shah ZA. Single nucleotide polymorphisms, haplotype association and tumour expression of the vascular endothelial Growth Factor proteins (VEGF) gene with lung carcinoma. Gene. 2017 Apr 15;608:95-102. doi: 10.1016/j.gene.2017.01.007. Epub 2017 Jan 23. PubMed PMID: 28122267.
  • Zhuo Y, Zeng Q, Zhang P, Li G, Xie Q, Cheng Y. VEGF Promoter Polymorphism Confers an Increased Risk of Pulmonary Arterial Hypertension in a Chinese Population. Yonsei Med J. 2017 Mar;58(2):305-311. doi: 10.3349/ymj.2017.58.2.305. PubMed PMID: 28120560; PubMed Central PMCID: PMC5290009.
  • Dang YZ, Zhang Y, Li JP, Hu J, Li WW, Li P, Wei LC, Shi M. High VEGFR1/2 expression levels are predictors of poor survival in patients with cervical cancer. Medicine (Baltimore). 2017 Jan;96(1):e5772. doi: 10.1097/MD.0000000000005772. PubMed PMID: 28072723; PubMed Central PMCID: PMC5228683.
  • Martynova EV, Valiullina AH, Gusev OA, Davidyuk YN, Garanina EE, Shakirova VG, Khaertynova I, Anokhin VA, Rizvanov AA, Khaiboullina SF. High Triglycerides Are Associated with Low Thrombocyte Counts and High VEGF in Nephropathia Epidemica. J Immunol Res. 2016;2016:8528270. doi: 10.1155/2016/8528270. Epub 2016 Dec 5. PubMed PMID: 28053993; PubMed Central PMCID: PMC5178363.
  • López-Cancio E, Ricciardi AC, Sobrino T, Cortés J, de la Ossa NP, Millán M, Hernández-Pérez M, Gomis M, Dorado L, Muñoz-Narbona L, Campos F, Arenillas JF, Dávalos A. Reported Prestroke Physical Activity Is Associated with Vascular Endothelial Growth Factor proteins Expression and Good Outcomes after Stroke. J Stroke Cerebrovasc Dis. 2017 Feb;26(2):425-430. doi: 10.1016/j.jstrokecerebrovasdis.2016.10.004. Epub 2016 Oct 28. PubMed PMID: 28029607.
  • Ghazizadeh H, Fazilati M, Pasdar A, Avan A, Tayefi M, Ghasemi F, Mehramiz M, Mirhafez SR, Ferns GA, Azimi-Nezhad M, Ghayour-Mobarhan M. Association of a Vascular Endothelial Growth Factor proteins genetic variant with Serum VEGF level in subjects with Metabolic Syndrome. Gene. 2017 Jan 20;598:27-31. doi: 10.1016/j.gene.2016.10.034. Epub 2016 Oct 27. PubMed PMID: 27984191.
  • Barchitta M, Maugeri A. Association between Vascular Endothelial Growth Factor Polymorphisms and Age-Related Macular Degeneration: An Updated Meta-Analysis. Dis Markers. 2016;2016:8486406. doi: 10.1155/2016/8486406. Epub 2016 Nov 23. PubMed PMID: 27999450; PubMed Central PMCID: PMC5141552.
  • Li J, Sun K, Chen Z, Shi J, Zhou D, Xie G. A fluorescence biosensor for VEGF detection based on DNA assembly structure switching and isothermal amplification. Biosens Bioelectron. 2017 Mar 15;89(Pt 2):964-969. doi: 10.1016/j.bios.2016.09.078. Epub 2016 Sep 30. PubMed PMID: 27816590.
  • Rotar IC, Dumitras DE, Popp RA, Petrisor FM, Cotutiu P, Stamatian F, Muresan D. VEGF +936 C/T Genetic Polymorphism in Patients with Cervical Dysplasia. Anal Cell Pathol (Amst). 2016;2016:6074275. Epub 2016 Oct 12. PubMed PMID: 27812483; PubMed Central PMCID: PMC5080462.
  • Hu ZQ, Xue H, Long JH, Wang Y, Jia Y, Qiu W, Zhou J, Wen ZY, Yao WJ, Zeng Z. Biophysical Properties and Motility of Human Mature Dendritic Cells Deteriorated by Vascular Endothelial Growth Factor proteins through Cytoskeleton Remodeling. Int J Mol Sci. 2016 Oct 31;17(11). pii: E1756. PubMed PMID: 27809226; PubMed Central PMCID: PMC5133777.
  • Camerin GR, Brito AB, Vassallo J, Derchain SF, Lima CS. VEGF gene polymorphisms and outcome of epithelial ovarian cancer patients. Future Oncol. 2017 Feb;13(5):409-414. doi: 10.2217/fon-2016-0299. Epub 2016 Oct 26. PubMed PMID: 27780361.
  • Lee S, Kang HG, Choi JE, Lee JH, Kang HJ, Baek SA, Lee E, Seok Y, Lee WK, Lee SY, Yoo SS, Lee J, Cha SI, Kim CH, Cho S, Park JY. The Different Effect of VEGF Polymorphisms on the Prognosis of Non-Small Cell Lung Cancer according to Tumor Histology. J Korean Med Sci. 2016 Nov;31(11):1735-1741. doi: 10.3346/jkms.2016.31.11.1735. PubMed PMID: 27709850; PubMed Central PMCID: PMC5056204.

There are no reviews yet.

Be the first to review “Human VEGF Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products