Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ranibizumab Biosimilar – Anti-VEGF mAb – Research Grade

  • PX-TA1008-50
  • Validated ELISA FC
Isotype:
FabG1

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade

Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Product name PX-TA1008-50
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Clonality Monoclonal Antibody
Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Expression system Mammalian cells
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Clonality Monoclonal Antibody

General information about Ranibizumab

Ranibizumab is a monoclonal antibody fragment (Fab) created from the same parent mouse antibody as bevacizumab. It is an anti-angiogenic that has been approved to treat the “wet” type of age-related macular degeneration (AMD, also ARMD), diabetic retinopathy, and macular edema due to branch retinal vein occlusion or central retinal vein occlusion. This product is for research use only.

SDS-PAGE for Ranibizumab Biosimilar - Anti-VEGF mAb

SDS-PAGE for Ranibizumab Biosimilar - Anti-VEGF mAb

Ranibizumab Biosimilar - Anti-VEGF mAb, on SDS-PAGE under non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ranibizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Ranibizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind Ranibizumab Biosimilar - Anti-VEGF mAb (cat. No.PX-TA1008) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 22.11M.

Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade binds to Human VEGF Recombinant Protein in ELISA Assay

Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade binds to Human VEGF Recombinant Protein in ELISA Assay

Human VEGF Recombinant Protein(cat. No.PX-P1060) at 0.5µg/mL (100µL/well) can bind Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade

There are no reviews yet.

Be the first to review “Ranibizumab Biosimilar – Anti-VEGF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products