Human TNFa Recombinant Protein

Reference:
Brand

Product type

Host Species

Size

, ,

Description of Human TNFa Recombinant Protein

Product nameHuman TNFa Recombinant Protein
Uniprot IDP01375
Uniprot linkhttp://www.uniprot.org/uniprot/P01375
Origin speciesHomo sapiens (Human)
Expression systemEukaryotic expression
SequenceMGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGC PSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQ VYFGIIAL
Molecular weight18.56 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS,pH 7.5
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesMammalian cells
Fragment TypePartial
NCBI ReferenceP01375
Aliases /SynonymsDIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa
ReferencePX-P3058
Related ProductsPX-TA1088
NoteFor research use only

Reviews

There are no reviews yet.

Be the first to review “Human TNFa Recombinant Protein”

Your email address will not be published. Required fields are marked *

Clear
OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us to order

+33 (0)3 90 20 54 70

Write us

Categories: