Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tumor necrosis factor(TNF)

Host species:
Mammalian cells
Uniprot ID:
P51742

210.00

50ug + 210 loyalty points
Val77–Leu233
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tumor necrosis factor(TNF)

Product name Tumor necrosis factor(TNF)
Uniprot ID P51742
Uniprot link http://www.uniprot.org/uniprot/P51742
Expression system Eukaryotic expression
Raw Antigen Sequence VKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val77-Leu233
Aliases /Synonyms Cachectin,TNF-alpha,Tumor necrosis factor ligand superfamily member 2,TNF-a,TNFA, TNFSF2
Reference PX-P4641
Note For research use only
Molecular Constructor
Val77–Leu233
Product name Tumor necrosis factor(TNF)
Uniprot ID P51742
Uniprot link http://www.uniprot.org/uniprot/P51742
Expression system Eukaryotic expression
Raw Antigen Sequence VKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Val77-Leu233
Aliases /Synonyms Cachectin,TNF-alpha,Tumor necrosis factor ligand superfamily member 2,TNF-a,TNFA, TNFSF2
Reference PX-P4641
Note For research use only
Molecular Constructor
Val77–Leu233

General Information about Tumor necrosis factor (TNF)

Tumor necrosis factor (TNF, cachexia or cachexia protein

Tumor necrosis factor(TNF)

There are no reviews yet.

Be the first to review “Tumor necrosis factor(TNF)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products