Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TNFa Recombinant Protein

  • PX-P3058-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01375
Molecular weight:
18.56 kDa

Original price was: €306.00.Current price is: €259.00.

50ug 15% OFF + 259 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TNFa Recombinant Protein

Product name PX-P3058-1MG
Uniprot ID P01375
Uniprot link http://www.uniprot.org/uniprot/P01375
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 18.56 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference P01375
Aliases /Synonyms DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa, cachexin
Reference PX-P3058
Note For research use only.
Molecular Constructor
Partial Yes
Product name Human TNFa Recombinant Protein
Uniprot ID P01375
Uniprot link http://www.uniprot.org/uniprot/P01375
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGC PSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQ VYFGIIAL
Molecular weight 18.56 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference P01375
Aliases /Synonyms DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa, cachexin
Reference PX-P3058
Note For research use only
Molecular Constructor
Partial Yes
Product name Human TNFa Recombinant Protein
Uniprot ID P01375
Uniprot link http://www.uniprot.org/uniprot/P01375
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGC PSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQ VYFGIIAL
Molecular weight 18.56 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference P01375
Aliases /Synonyms DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa, cachexin
Reference PX-P3058
Note For research use only
Molecular Constructor
Partial Yes

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade (cat. No.PX-TA1024) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 105.9M.

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade (cat. No.PX-TA1001) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 142.1M.

Infliximab Biosimilar - Anti-TNF-alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Infliximab Biosimilar - Anti-TNF-alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Infliximab Biosimilar - Anti-TNF-alpha mAb (cat. No.PX-TA1009) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 60.68M.

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb (cat. No.PX-TA1129) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.028M.

Human TNFa Recombinant Protein

There are no reviews yet.

Be the first to review “Human TNFa Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products