Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
CD58 protein(CD58) H146Y
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD58 protein(CD58) H146Y |
|---|---|
| Uniprot ID | P19256 |
| Uniprot link | http://www.uniprot.org/uniprot/P19256 |
| Expression system | Eukaryotic expression |
| Sequence | MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR |
| Molecular weight | 25.19KDa(40kDa) |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Arg215 |
| Aliases /Synonyms | LFA3,Ag3,Surface glycoprotein LFA-3,CD58 |
| Reference | PX-P4548 |
| Note | For research use only |
Description of CD58 protein(CD58) H146Y
General Information about CD58 protein (CD58)
Neural cell adhesion molecule (NCAM, which is also a cluster of differentiated CD56) is a homotypic binding glycoprotein expressed on the surface of neurons, glial, skeletal muscle and natural killer cells. NCAM is believed to play a role in cell adhesion, neurite outgrowth, synaptic plasticity, and learning and memory.
Related products
Biosimilar
Relatlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade
PX-TA1496 200€
Biosimilar
Ieramilimab Biosimilar – Anti-LAG3 mAb – Research Grade
PX-TA1562 200€
Biosimilar
Encelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade
PX-TA1586 200€
Biosimilar
Fianlimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade
PX-TA1588 200€
Biosimilar
Mavezelimab Biosimilar – Anti-LAG3, CD223 mAb – Research Grade
PX-TA1595 200€
Biosimilar
Miptenalimab Biosimilar – Anti-LAG3 mAb – Research Grade
PX-TA1686 370€
Biosimilar
Tebotelimab Biosimilar – Anti-PDCD1;LAG3 mAb – Research Grade
PX-TA1722 200€
Biosimilar
Bavunalimab Biosimilar – Anti-LAG3;CTLA4 mAb – Research Grade
PX-TA1813 200€
Biosimilar
Favezelimab Biosimilar – Anti-LAG3 mAb – Research Grade
PX-TA1838 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.