Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD223 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P18627
Molecular weight:
60kDa

€420.00

+ 420 loyalty points
Met1–Leu450 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay
Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

CD223 Recombinant Protein

Product name CD223 Recombinant Protein
Uniprot ID P18627
Uniprot link http://www.uniprot.org/uniprot/P18627
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
Molecular weight 60kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Leu450
Aliases /Synonyms LAG3
Reference PX-P4110
Note For research use only
Background information Array
Molecular Constructor
Met1–Leu450 His

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Ieramilimab Biosimilar - Anti-LAG3 mAb binds to CD223 Recombinant Protein in indirect ELISA Assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind to Ieramilimab Biosimilar - Anti-LAG3 mAb (cat. No.PX-TA1562) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade (cat. No.PX-TA1838) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 9.284M.

There are no reviews yet.

Be the first to review “CD223 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products