Brand: ProteoGenix

CD152 Recombinant Protein

PX-P4108-50
Validated ELISA

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P16410
Molecular weight:: 18.51kDa

Original price was: €115.00.Current price is: €97.00.

50ug 16% OFF + 97 loyalty points

Met1~Asp161 His

Size Size

50ug Original price was: €115.00.Current price is: €97.00.
100ug Original price was: €161.00.Current price is: €139.00.
1MG Original price was: €455.00.Current price is: €403.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in indirect ELISA Assay

Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade binds to CD152 Recombinant Protein in ELISA assay

Datasheet

CD152 Recombinant Protein

Product name	PX-P4108-100
Uniprot ID	P16410
Uniprot link	http://www.uniprot.org/uniprot/P16410
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
Molecular weight	18.51kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Asp161
Aliases /Synonyms	CD152
Reference	PX-P4108
Note	For research use only
Molecular Constructor	Met1~Asp161 His

Product name	PX-P4108-1MG
Uniprot ID	P16410
Uniprot link	http://www.uniprot.org/uniprot/P16410
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
Molecular weight	18.51kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Asp161
Aliases /Synonyms	CD152
Reference	PX-P4108
Note	For research use only
Molecular Constructor	Met1~Asp161 His

Product name	PX-P4108-50
Uniprot ID	P16410
Uniprot link	http://www.uniprot.org/uniprot/P16410
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
Molecular weight	18.51kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1~Asp161
Aliases /Synonyms	CD152
Reference	PX-P4108
Note	For research use only
Molecular Constructor	Met1~Asp161 His

General information on CD152 Recombinant Protein:

CD152, also known as CTLA4 and cytotoxic T lymphocyte protein 4, is a single-pass type I membrane protein and a member of the immunoglobulin superfamily. It is the second member of the CD28 receptor. The ligands or counterreceptors of these two proteins belong to the B7, CD8 (B7-1) and CD86 (B7-2) families. CTLA4 delivers inhibitory signals to T lymphocytes, while CD28 delivers stimulatory signals. Intracellular CTLA4 is also present in regulatory T cells and may play an important role in its function. CD152 antigen or cytotoxic T lymphocytes (CTLA-4) are important receptors involved in downregulating T-cell activation. Due to its far-reaching inhibitory effect, CD152 is considered a candidate solid acceptable for autoimmunity and a convincing target for cancer immunotherapy. In particular, recent evidence suggests that CD152 is also important in homeostasis and the function of population suppressor cells called regulatory T cells (Treg).

Datasheet

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in indirect ELISA Assay

Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind to Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb (cat. No.PX-TA1177) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade binds to CD152 Recombinant Protein in ELISA assay

Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade (cat. No.PX-TA1559) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 58.31M.