Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Erfonrilimab Biosimilar – Anti-CD274;CTLA4 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Bispecific Single Domains (VH-VH'-CH),IgG1na;na

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade

Product name Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade
Uniprot ID P16410 & Q9NZQ7
Source CAS 2367013-69-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Erfonrilimab,ERFONRILIMAB, ERFONRILIMAB, KN046,CD274;CTLA4,anti-CD274;CTLA5
Reference PX-TA1665
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Single Domains (VH-VH'-CH),IgG1na;na
Clonality Monoclonal Antibody
Product name Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade
Uniprot ID P16410 & Q9NZQ7
Source CAS 2367013-69-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Erfonrilimab,ERFONRILIMAB, ERFONRILIMAB, KN046,CD274;CTLA4,anti-CD274;CTLA5
Reference PX-TA1665
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Single Domains (VH-VH'-CH),IgG1na;na
Clonality Monoclonal Antibody
Product name PX-TA1665-50
Uniprot ID P16410 & Q9NZQ7
Source CAS 2367013-69-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Erfonrilimab,ERFONRILIMAB, ERFONRILIMAB, KN046,CD274;CTLA4,anti-CD274;CTLA5
Reference PX-TA1665
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Single Domains (VH-VH'-CH),IgG1na;na
Clonality Monoclonal Antibody

Erfonrilimab Biosimilar: A Promising Antibody for Targeting CD274 and CTLA4

Erfonrilimab Biosimilar, also known as Anti-CD274,CTLA4 mAb, is a novel antibody currently in development for its potential therapeutic applications. This biosimilar antibody is designed to target two important immune checkpoint molecules, CD274 (also known as PD-L1) and CTLA4, which play a crucial role in regulating the immune response. In this article, we will provide a detailed scientific description of the structure, activity, and potential applications of Erfonrilimab Biosimilar.

Structure of Erfonrilimab Biosimilar

Erfonrilimab Biosimilar is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is a biosimilar version of the original antibody, which means it has a highly similar structure and function to the reference product. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains are made up of constant and variable regions, while the light chains only have variable regions.

The variable regions of the antibody are responsible for recognizing and binding to its target molecules, CD274 and CTLA4. These regions are highly specific and have a unique three-dimensional structure that allows them to bind to their targets with high affinity. The constant regions, on the other hand, are responsible for the effector functions of the antibody, such as activating the immune response and triggering cell death in target cells.

Activity of Erfonrilimab Biosimilar

Erfonrilimab Biosimilar is a dual-targeting antibody that binds to both CD274 and CTLA4. CD274 is a protein that is expressed on the surface of various cells, including cancer cells, and plays a key role in suppressing the immune response. By binding to CD274, Erfonrilimab Biosimilar blocks its interaction with its receptor, PD-1, on T cells, thereby preventing the suppression of the immune response. This results in the activation of T cells and the enhancement of their anti-tumor activity.

Similarly, CTLA4 is another immune checkpoint molecule that is expressed on the surface of T cells. It plays a critical role in regulating the immune response by inhibiting the activation of T cells. By binding to CTLA4, Erfonrilimab Biosimilar blocks its inhibitory activity, leading to the activation of T cells and the enhancement of their anti-tumor activity. Moreover, the binding of Erfonrilimab Biosimilar to CTLA4 also promotes the activation of other immune cells, such as natural killer cells and macrophages, which further contribute to the anti-tumor response.

Potential Applications of Erfonrilimab Biosimilar

Erfonrilimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential therapeutic applications. The primary indication for this biosimilar antibody is in the treatment of various types of cancer, including melanoma, non-small cell lung cancer, and bladder cancer. By targeting CD274 and CTLA4, Erfonrilimab Biosimilar has the potential to enhance the anti-tumor immune response and improve the outcomes of cancer treatment.

In addition to cancer, Erfonrilimab Biosimilar may also have potential applications in other diseases where immune dysregulation plays a role. This includes autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, as well as infectious diseases, such as HIV and hepatitis B. By modulating the immune response, Erfonrilimab Biosimilar has the potential to improve the outcomes of these diseases and provide a new treatment option for patients.

Conclusion

In summary, Erfonrilimab Biosimilar is a promising antibody that targets two important immune checkpoint molecules, CD274 and CTLA4. Its unique structure and activity make

SDS-PAGE for Erfonrilimab Biosimilar - Anti-CD274,CTLA4 mAb - Research Grade

SDS-PAGE for Erfonrilimab Biosimilar - Anti-CD274,CTLA4 mAb - Research Grade

Erfonrilimab Biosimilar - Anti-CD274,CTLA4 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Erfonrilimab Biosimilar – Anti-CD274;CTLA4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products