Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nurulimab Biosimilar – Anti-CTLA4 mAb – Research Grade

  • PX-TA1597-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Product name Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Nurulimab ,BCD-145,CTLA4,anti-CTLA4
Reference PX-TA1597
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Nurulimab ,BCD-145,CTLA4,anti-CTLA4
Reference PX-TA1597
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1597-50
Uniprot ID P16410
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nurulimab ,BCD-145,CTLA4,anti-CTLA4
Reference PX-TA1597
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Nurulimab Biosimilar: A Promising Anti-CTLA4 mAb for

Cancer Immunotherapy Introduction

Nurulimab Biosimilar, also known as anti-CTLA4 mAb, is a therapeutic antibody that has shown promising results in cancer immunotherapy. This biosimilar is designed to target CTLA4, a protein found on the surface of immune cells, and is being developed as a research grade product for preclinical studies. In this article, we will discuss the structure, activity and potential applications of Nurulimab Biosimilar in cancer treatment.

Structure of Nurulimab Biosimilar

Nurulimab Biosimilar is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is a humanized IgG1 antibody, meaning that it contains both human and murine (mouse) components. The variable region of the antibody, which is responsible for binding to its target, is derived from a mouse anti-CTLA4 antibody, while the constant region is of human origin. This humanization process reduces the risk of immune reactions and improves the stability and half-life of the antibody in the body.

The antibody has a typical Y-shaped structure, with two heavy chains and two light chains. Each chain consists of a variable region and a constant region. The variable region of the heavy and light chains come together to form the antigen-binding site, which is specific for CTLA4. This binding site is responsible for the therapeutic activity of Nurulimab Biosimilar.

Activity of Nurulimab Biosimilar

Nurulimab Biosimilar works by blocking the activity of CTLA4, a protein that plays a critical role in regulating the immune response. CTLA4 is found on the surface of T cells, a type of immune cell that helps to fight off infections and cancer cells. However, in some cases, CTLA4 can also suppress the immune response, allowing cancer cells to grow and spread.

By binding to CTLA4, Nurulimab Biosimilar prevents it from interacting with its natural ligands, CD80 and CD86, which are found on the surface of antigen-presenting cells. This interaction is necessary for the inhibitory function of CTLA4. By blocking this interaction, Nurulimab Biosimilar enhances the activity of T cells, allowing them to mount a stronger attack against cancer cells.

Potential Applications of Nurulimab Biosimilar

Nurulimab Biosimilar has shown promising results in preclinical studies as a potential treatment for various types of cancer. It has been studied in combination with other immunotherapies, such as anti-PD1 antibodies, and has shown synergistic effects in enhancing the anti-tumor immune response.

The most advanced clinical trial of Nurulimab Biosimilar is currently in phase I/II for the treatment of advanced solid tumors. This trial aims to evaluate the safety, tolerability and preliminary efficacy of the biosimilar in combination with chemotherapy. Other ongoing studies are investigating the use of Nurulimab Biosimilar in combination with other therapies, such as radiotherapy and targeted therapies, for various types of cancer.

Furthermore, Nurulimab Biosimilar has also shown potential as a treatment for autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. By blocking the activity of CTLA4, it can help to reduce the overactive immune response that is characteristic of these diseases.

Conclusion

Nurulimab Biosimilar is a promising anti-CTLA4 mAb that has the potential to improve cancer treatment by enhancing the anti-tumor immune response. Its unique structure and mechanism of action make it a valuable addition to the arsenal of immunotherapies currently available. With ongoing clinical trials and further research, Nurulimab Biosimilar may soon become a valuable therapeutic option for patients with cancer and autoimmune diseases.

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade

SDS-PAGE for Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Nurulimab Biosimilar - Anti-CTLA4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Nurulimab  Biosimilar - Anti-CTLA4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Nurulimab Biosimilar – Anti-CTLA4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products