Brand: ProteoGenix

Tremelimumab Biosimilar – Anti-CTLA4, CD152 mAb – Research Grade

PX-TA1177-100UG
Validated ELISA

Isotype:: IgG2, Kappa

Original price was: €250.00.Current price is: €200.00.

100ug 20% OFF + 200 loyalty points

Size Size

50ug Original price was: €195.00.Current price is: €140.00.
100ug Original price was: €250.00.Current price is: €200.00.
1MG Original price was: €531.00.Current price is: €405.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in Indirect ELISA Assay

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade

Product name	Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID	P16410
Source	CAS 745013-59-6
Species	Homo sapiens
Expression system	Mammalian
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB
Aliases /Synonyms	Tremelimumab,Ticilimumab, CP-675,CP-675,206,CP-675206 clone 11.2.1,CTLA4, CD152,anti-CTLA4, CD152
Reference	PX-TA1177
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG2-kappa
Clonality	Monoclonal Antibody

Product name	Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID	P16410
Source	CAS 745013-59-6
Species	Homo sapiens
Expression system	Mammalian cells
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Applications	ELISA,WB,,,
Aliases /Synonyms	Tremelimumab,Ticilimumab, CP-675,CP-675,206,CP-675206 clone 11.2.1,CTLA4, CD152,anti-CTLA4, CD152
Reference	PX-TA1177
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG2-kappa
Clonality	Monoclonal Antibody

Product name	PX-TA1177-50
Uniprot ID	P16410
Source	CAS 745013-59-6
Species	Homo sapiens
Expression system	Mammalian
Raw Antigen Sequence	MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity	>85%
Buffer	PBS buffer PH7.5
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Delivery Time	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	store at -80°C
Brand	ProteoGenix
Aliases /Synonyms	Tremelimumab,Ticilimumab, CP-675,CP-675,206,CP-675206 clone 11.2.1,CTLA4, CD152,anti-CTLA4, CD152
Reference	PX-TA1177
Note	For research use only. Not suitable for clinical or therapeutic use.
Isotype	IgG2, Kappa

General information on Anti-CTLA4/CD152(Homo sapiens) (Tremelimumab) Monoclonal Antibody

Tremelimumab is studied for the treatment of Mesothelioma, Liver Neoplasms, Liver Cancer, Liver Cell Caricinoma, and HepatoCellular Carcinoma.

SDS-PAGE for Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb binds to CD152 Recombinant Protein in Indirect ELISA Assay

Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind to Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb (cat. No.PX-TA1177) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450