Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zalifrelimab Biosimilar – Anti-CTLA4, CD152 mAb – Research Grade

  • PX-TA1559-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €176.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Zalifrelimab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade

Product name Zalifrelimab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS 2148321-69-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Zalifrelimab ,AGEN1884,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1559
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Zalifrelimab Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS 2148321-69-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Zalifrelimab ,AGEN1884,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1559
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1559-50
Uniprot ID P16410
Source CAS 2148321-69-9
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Zalifrelimab ,AGEN1884,CTLA4, CD152,anti-CTLA4, CD152
Reference PX-TA1559
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Zalifrelimab Biosimilar, also known as Anti-CTLA4 or CD152 monoclonal antibody, is a research grade therapeutic antibody that has been developed as a potential treatment for various types of cancer. This biosimilar is designed to mimic the activity of the original antibody, Ipilimumab, which has been approved by the FDA for the treatment of melanoma. In this article, we will explore the structure, activity, and potential applications of Zalifrelimab Biosimilar.

Structure of Zalifrelimab Biosimilar

Zalifrelimab Biosimilar is a recombinant monoclonal antibody that is produced in a laboratory using recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions of the antibody are responsible for binding to its target, while the constant regions provide stability and effector functions.

The structure of Zalifrelimab Biosimilar is very similar to that of the original antibody, Ipilimumab. Both antibodies are of the IgG1 isotype and have a similar overall shape. However, Zalifrelimab Biosimilar has been engineered to have a higher binding affinity for its target, making it potentially more effective in treating cancer.

Activity of Zalifrelimab Biosimilar

Zalifrelimab Biosimilar works by targeting a protein called CTLA-4, which is found on the surface of certain immune cells, including T cells. CTLA-4 is a negative regulator of T cell activation, meaning it helps to keep the immune response in check. However, in cancer, this protein is often overexpressed, leading to suppression of the immune response and allowing the tumor to grow unchecked.

By binding to CTLA-4, Zalifrelimab Biosimilar blocks its activity and allows T cells to become activated and attack cancer cells. This leads to an enhanced immune response against the tumor, potentially slowing its growth and improving patient outcomes.

Therapeutic Target of Zalifrelimab Biosimilar

The therapeutic target of Zalifrelimab Biosimilar is CTLA-4, a protein that is involved in regulating the immune response. This protein is found on the surface of T cells and helps to prevent them from becoming overactive. However, in cancer, CTLA-4 is often overexpressed, leading to suppression of the immune response and allowing the tumor to grow.

Zalifrelimab Biosimilar is designed to specifically target and bind to CTLA-4, blocking its activity and allowing T cells to become activated. This leads to an enhanced immune response against the tumor, potentially slowing its growth and improving patient outcomes.

Potential Applications of Zalifrelimab Biosimilar

Zalifrelimab Biosimilar has shown promise as a potential treatment for various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. It is currently being evaluated in clinical trials for these indications and has shown promising results in early studies.

In addition to its potential as a monotherapy, Zalifrelimab Biosimilar is also being studied in combination with other cancer treatments, such as chemotherapy and other immunotherapies. This is because the combination of different treatments can often lead to a more effective and comprehensive attack on the tumor.

Conclusion

Zalifrelimab Biosimilar, also known as Anti-CTLA4 or CD152 monoclonal antibody, is a research grade therapeutic antibody designed to mimic the activity of the original antibody, Ipilimumab. It works by targeting CTLA-4, a protein found on the surface of T cells, and blocking its activity to enhance the immune response against cancer. This biosimilar has shown promise in clinical trials for various types of cancer and has the potential to improve patient outcomes. Further research and development of Zalifrelimab Biosimilar could lead to a new and

Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade binds to CD152 Recombinant Protein in ELISA assay

Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade binds to CD152 Recombinant Protein in ELISA assay

Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind Zalifrelimab Biosimilar - Anti-CD152;CTLA4 mAb - Research Grade (cat. No.PX-TA1559) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 58.31M.

Zalifrelimab  Biosimilar - Anti-CTLA4, CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Zalifrelimab Biosimilar – Anti-CTLA4, CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products