Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tuvonralimab Biosimilar – Anti-CTLA4 mAb – Research Grade

  • PX-TA1781-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €311.00.Current price is: €259.00.

50ug 17% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Product name Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2417649-44-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tuvonralimab,PBS-105, PBS105, PSB-205, QL1706,CTLA4,anti-CTLA4
Reference PX-TA1781
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2417649-44-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tuvonralimab,PBS-105, PBS105, PSB-205, QL1706,CTLA4,anti-CTLA4
Reference PX-TA1781
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1781-50
Uniprot ID P16410
Source CAS: 2417649-44-4
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tuvonralimab,PBS-105, PBS105, PSB-205, QL1706,CTLA4,anti-CTLA4
Reference PX-TA1781
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Tuvonralimab Biosimilar – A Potent Anti-CTLA4 Monoclonal Antibody Introduction

Tuvonralimab Biosimilar is a novel monoclonal antibody (mAb) that targets the immune checkpoint protein CTLA4. This biosimilar is designed to mimic the structure and function of the approved anti-CTLA4 mAb, ipilimumab, and has shown promising results in preclinical studies. In this article, we will explore the structure, activity, and potential applications of Tuvonralimab Biosimilar as a research-grade therapeutic antibody.

Structure of Tuvonralimab Biosimilar

Tuvonralimab Biosimilar is a fully humanized IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of Tuvonralimab Biosimilar is responsible for its specificity towards CTLA4, while the constant region mediates effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

The amino acid sequence of Tuvonralimab Biosimilar is highly similar to that of ipilimumab, with only a few differences in the constant region. This similarity allows for the biosimilar to have a similar binding affinity and biological activity as the approved drug.

Mechanism of Action

Tuvonralimab Biosimilar exerts its therapeutic effects by blocking the interaction between CTLA4 and its ligands, CD80 and CD86, on antigen-presenting cells. This interaction is crucial for the suppression of T cell activation and proliferation, which is a mechanism used by cancer cells to evade the immune system. By inhibiting CTLA4, Tuvonralimab Biosimilar enhances the activation and proliferation of T cells, leading to a stronger anti-tumor immune response.

In addition to its inhibitory effects on CTLA4, Tuvonralimab Biosimilar also has the potential to induce ADCC and CDC, which can further enhance its anti-tumor activity. This is due to the presence of the Fc region in its structure, which can bind to Fc receptors on immune cells and trigger their cytotoxic functions.

Potential Applications

Tuvonralimab Biosimilar is currently being evaluated as a potential treatment for various types of cancer, including melanoma, non-small cell lung cancer, and renal cell carcinoma. It is also being studied in combination with other cancer therapies, such as chemotherapy and other immune checkpoint inhibitors, to enhance its efficacy.

As a research-grade antibody, Tuvonralimab Biosimilar can also be used in laboratory studies to investigate the role of CTLA4 in immune regulation and to develop new immunotherapeutic approaches. Its high specificity and potency make it a valuable tool for researchers in the field of cancer immunology.

Conclusion

Tuvonralimab Biosimilar is a promising anti-CTLA4 monoclonal antibody with a similar structure and mechanism of action to the approved drug, ipilimumab. Its potential applications in cancer treatment and research make it a valuable addition to the arsenal of immunotherapies. Further clinical trials are needed to fully evaluate its safety and efficacy, but early results have shown promising anti-tumor activity. With the growing interest in immune checkpoint inhibitors, Tuvonralimab Biosimilar has the potential to become a valuable therapeutic option for cancer patients.

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade in ELISA Assay

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

SDS-PAGE for Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tuvonralimab Biosimilar - Anti-CTLA4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tuvonralimab Biosimilar – Anti-CTLA4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products