Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lorigerlimab Biosimilar – Anti-CTLA4 & PD1 mAb – Research Grade

  • PX-TA1765-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
[V-kappa’-VH-h-CH2-CH3_V-kappa-VH’]2

Original price was: €171.00.Current price is: €140.00.

50ug 18% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Lorigerlimab Biosimilar - Anti-CTLA4 & PD1 mAb - Research Grade

Product name Lorigerlimab Biosimilar - Anti-CTLA4 & PD1 mAb - Research Grade
Uniprot ID P16410 & Q15116
Source CAS: 2416595-46-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lorigerlimab,MGD 019, MGD-019, MGD019,CTLA4 & PD1,anti-CTLA4 & PD1
Reference PX-TA1765
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [V-kappa’-VH-h-CH2-CH3_V-kappa-VH’]2
Clonality Monoclonal Antibody
Product name Lorigerlimab Biosimilar - Anti-CTLA4 & PD1 mAb - Research Grade
Uniprot ID P16410 & Q15116
Source CAS: 2416595-46-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lorigerlimab,MGD 019, MGD-019, MGD019,CTLA4 & PD1,anti-CTLA4 & PD1
Reference PX-TA1765
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [V-kappa’-VH-h-CH2-CH3_V-kappa-VH’]2
Clonality Monoclonal Antibody
Product name PX-TA1765-50
Uniprot ID P16410 & Q15116
Source CAS: 2416595-46-3
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lorigerlimab,MGD 019, MGD-019, MGD019,CTLA4 & PD1,anti-CTLA4 & PD1
Reference PX-TA1765
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [V-kappa’-VH-h-CH2-CH3_V-kappa-VH’]2
Clonality Monoclonal Antibody

Introduction to Lorigerlimab Biosimilar – Anti-CTLA4 & PD1 mAb – Research Grade Lorigerlimab Biosimilar, also known as Anti-CTLA4 & PD1 mAb, is a promising therapeutic antibody that has shown potential in the treatment of various diseases. This biosimilar is a monoclonal antibody (mAb) that targets two important immune checkpoints, CTLA4 and PD1, and has the potential to revolutionize the field of immunotherapy. In this article, we will delve into the structure, activity, and potential applications of Lorigerlimab Biosimilar.

Structure of Lorigerlimab Biosimilar

Lorigerlimab Biosimilar is a recombinant humanized IgG4 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each with a variable region that binds to the target antigens CTLA4 and PD1. The constant region of the antibody is responsible for its effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Lorigerlimab Biosimilar

Lorigerlimab Biosimilar works by blocking the interaction of CTLA4 and PD1 with their respective ligands, CD80/86 and PD-L1. These interactions are crucial for regulating the activity of T cells, which play a central role in the immune response. By blocking these checkpoints, Lorigerlimab Biosimilar allows for the activation and proliferation of T cells, leading to a more robust and effective immune response against cancer and other diseases.

In addition to its primary activity of checkpoint inhibition, Lorigerlimab Biosimilar also has other potential mechanisms of action. It has been shown to induce antibody-dependent cellular phagocytosis (ADCP), which involves the destruction of target cells by immune cells such as macrophages. This mechanism can further enhance the efficacy of Lorigerlimab Biosimilar in cancer treatment.

Applications of Lorigerlimab Biosimilar

Lorigerlimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various cancers, including melanoma, non-small cell lung cancer, and renal cell carcinoma. It is also being investigated for its potential in treating autoimmune diseases such as rheumatoid arthritis and psoriasis.

One of the key advantages of Lorigerlimab Biosimilar is its potential to be used in combination with other therapies. Combination therapy has become a popular approach in cancer treatment, as it can enhance the efficacy of individual treatments and overcome resistance. Lorigerlimab Biosimilar has shown potential in combination with other checkpoint inhibitors, chemotherapy, and targeted therapies.

In addition to its therapeutic potential, Lorigerlimab Biosimilar also has research applications. Its ability to selectively target CTLA4 and PD1 makes it a valuable tool for studying the role of these checkpoints in various diseases. It can also be used in diagnostic assays to detect the expression of CTLA4 and PD1 in patient samples.

Conclusion

In summary, Lorigerlimab Biosimilar – Anti-CTLA4 & PD1 mAb – Research Grade is a promising therapeutic antibody with a unique mechanism of action. Its ability to block CTLA4 and PD1 checkpoints has the potential to enhance the immune response against cancer and other diseases. With ongoing clinical trials and research, Lorigerlimab Biosimilar has the potential to become a valuable addition to the arsenal of immunotherapies.

Lorigerlimab Biosimilar - Anti-CTLA4 &, PD1 mAb - Research Grade in ELISA Assay

Lorigerlimab Biosimilar - Anti-CTLA4 &amp, PD1 mAb - Research Grade in ELISA Assay

Lorigerlimab Biosimilar - Anti-CTLA4 &, PD1 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Lorigerlimab Biosimilar - Anti-CTLA4 &, PD1 mAb - Research Grade

SDS-PAGE for Lorigerlimab Biosimilar - Anti-CTLA4 &amp, PD1 mAb - Research Grade

Lorigerlimab Biosimilar - Anti-CTLA4 &, PD1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lorigerlimab Biosimilar - Anti-CTLA4 & PD1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Lorigerlimab Biosimilar – Anti-CTLA4 & PD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products