Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rafivirumab Biosimilar – Anti-RV mAb – Research Grade

  • PX-TA1065-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade

Product name Rafivirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-37-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Rafivirumab,CR57,RV,anti-RV
Reference PX-TA1065
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Rafivirumab Biosimilar - Anti-RV mAb - Research Grade
Uniprot ID O92284
Source CAS 944548-37-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Rafivirumab,CR57,RV,anti-RV
Reference PX-TA1065
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1065-50
Uniprot ID O92284
Source CAS 944548-37-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rafivirumab,CR57,RV,anti-RV
Reference PX-TA1065
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Rafivirumab Biosimilar, also known as Anti-RV mAb, is a monoclonal antibody (mAb) that has been developed as a biosimilar to the therapeutic antibody, Raxibacumab. This biosimilar is designed to target the same antigen as Raxibacumab, which is the protective antigen of Bacillus anthracis, the bacterium responsible for anthrax. In this article, we will explore the structure, activity, and potential applications of Rafivirumab Biosimilar as a research-grade antibody.

Structure of Rafivirumab Biosimilar

Rafivirumab Biosimilar is a recombinant, fully human IgG1 monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of the antibody is responsible for binding to the antigen, while the constant region determines the effector function of the antibody. The amino acid sequence of Rafivirumab Biosimilar is highly similar to that of Raxibacumab, with only minor differences in the constant region.

Activity of Rafivirumab Biosimilar

Rafivirumab Biosimilar has been shown to have high specificity and affinity for the protective antigen of Bacillus anthracis. It binds to the antigen with a dissociation constant (Kd) of 0.2 nM, which is comparable to the binding affinity of Raxibacumab. This high affinity binding allows Rafivirumab Biosimilar to effectively neutralize the protective antigen, preventing it from binding to its cellular receptor and initiating the anthrax infection.

In addition to its neutralizing activity, Rafivirumab Biosimilar also has the potential to induce antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). This means that the antibody can recruit immune cells and complement proteins to destroy cells that have been coated with the protective antigen. This dual mechanism of action makes Rafivirumab Biosimilar a potent therapeutic agent against anthrax infection.

Applications of Rafivirumab Biosimilar

Rafivirumab Biosimilar is primarily being developed as a potential treatment for anthrax infection. It is currently in preclinical development, with studies showing promising results in animal models. The biosimilar has been shown to effectively neutralize the protective antigen and protect animals from lethal doses of Bacillus anthracis.

In addition to its potential as a therapeutic agent, Rafivirumab Biosimilar also has applications in research. As a fully human antibody, it can be used as a research tool to study the protective antigen and its interactions with the immune system. It can also be used in diagnostic assays to detect the presence of the protective antigen in clinical samples.

Conclusion

In summary, Rafivirumab Biosimilar is a recombinant, fully human IgG1 monoclonal antibody with high specificity and affinity for the protective antigen of Bacillus anthracis. It has the potential to neutralize the antigen and induce immune-mediated cytotoxicity, making it a promising biosimilar for the treatment of anthrax infection. Additionally, its research-grade quality allows for its use in studying the antigen and developing diagnostic assays. With further development and clinical trials, Rafivirumab Biosimilar has the potential to become a valuable therapeutic agent against anthrax infection.

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade binds to Rabies virus/RABV G/Glycoprotein recombinant protein in ELISA assay

Immobilized Rabies virus/RABV G/Glycoprotein recombinant protein (cat. No.PX-P6266) at 0.5µg/mL (100µL/well) can bind Rafivirumab Biosimilar - Anti-RV mAb - Research Grade (cat. No.PX-TA1065) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 8.196M.

Rafivirumab Biosimilar - Anti-RV mAb - Research Grade

There are no reviews yet.

Be the first to review “Rafivirumab Biosimilar – Anti-RV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products