Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rafivirumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Rafivirumab ELISA Kit

Rafivirumab ELISA Kit

Product name Rafivirumab ELISA Kit
Uniprot ID O92284
Raw Antigen Sequence MVPQVLLFVPLLGFSLCFGKFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKYVLMTAGAMIGLVLIFSLMTWCRRANRPESKQRSFGGTGRNVSVTSQSGKVIPSWESYKSGGEIRL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX288
Note For research use only.
Sample type Plasma, Serum
Target Rafivirumab
Immunogen Rafivirumab

Introduction

Rafivirumab is a monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of respiratory syncytial virus (RSV) infections. It specifically targets the fusion protein of RSV, which plays a crucial role in the virus’s ability to enter and infect host cells. The use of Rafivirumab has shown promising results in preclinical studies and is now being evaluated in clinical trials. To facilitate research on this potential therapeutic, a Rafivirumab ELISA Kit has been developed for the detection and quantification of Rafivirumab in biological samples.

Structure of Rafivirumab

Rafivirumab is a monoclonal antibody, meaning it is produced by a single clone of immune cells. It is a fully humanized IgG1 antibody, with a molecular weight of approximately 150 kDa. The antibody consists of two heavy chains and two light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the target molecule, while the constant regions determine the antibody’s effector functions.

Activity of Rafivirumab

Rafivirumab binds to the fusion protein of RSV with high affinity and specificity. This binding prevents the fusion protein from interacting with its cellular receptor, thus inhibiting the virus’s ability to enter and infect host cells. In addition, Rafivirumab can also activate the immune system’s effector cells, such as natural killer cells and macrophages, to eliminate RSV-infected cells.

Application of Rafivirumab ELISA Kit

The Rafivirumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Rafivirumab in various biological samples, such as serum, plasma, and cell culture supernatant. This kit utilizes a sandwich ELISA format, where the target antibody is captured by a specific immobilized antibody and then detected by a labeled detection antibody. The detection antibody is conjugated with an enzyme, such as horseradish peroxidase, which produces a colorimetric signal in the presence of a substrate. The intensity of the signal is directly proportional to the amount of Rafivirumab present in the sample.

The Rafivirumab ELISA Kit has a wide range of applications, including pharmacokinetic studies, drug development, and clinical trials. It can be used to monitor the levels of Rafivirumab in patients receiving treatment, as well as to assess the efficacy of the antibody in inhibiting RSV infection. Furthermore, this kit can also be used to screen potential therapeutic candidates that target the fusion protein of RSV.

Conclusion

Rafivirumab is a promising therapeutic candidate for the treatment of RSV infections, and the development of the Rafivirumab ELISA Kit has provided researchers with a valuable tool for studying this potential drug. The kit’s high sensitivity and specificity make it a reliable method for detecting and quantifying Rafivirumab in various biological samples, and its wide range of applications make it a valuable asset in the field of RSV research. With ongoing clinical trials, the Rafivirumab ELISA Kit will continue to play a crucial role in the development and evaluation of this potential therapeutic agent.

Rafivirumab ELISA Kit

There are no reviews yet.

Be the first to review “Rafivirumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products