Trichinella spiralis NBL-1 Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameTrichinella spiralis NBL-1 Recombinant Protein
Uniprot IDQ9BJL7
Uniprot linkhttp://www.uniprot.org/uniprot/Q9BJL7
Origin speciesTrichinella spiralis
Expression systemProcaryotic expression
SequenceMAHNHRHKHKLAFECGVPHFKPYIWKSGRIVGGTDVRPHSHPWQIQLLKSETGGYSSLCGGSLVHFGKPSNGTRFVLTAA HCITTSNMYPRTSRFTVVTGAHNIKMHEKEKKRIPITSYYVQHWNPVMTTNDIALLRLAETVYYNEYTRPVCLPEPNEEL TPGDICVVTGWGDTTENGTTSNTLKQVGVKIMKKGTCANVRSEVITFCAGAMEGGKDSCQGDSGGPLICKKNGKSVQFGV VSYGTGCARKGYPGVYAKVPSYVTWLNKAAKELENSPEGTVKWASKEDSPVDLSTASRPTNPYTGSRPTSPSSGSRPTYP SSGSRPTSPSSGSRPTYPSSGSRPTYPSSGSRPTYPYTGSRPTPQKPVFPSYQKYPPAVQKYIDSLPSGTQGTLEYTVTQ NGVTTTTYYHFSK
Molecular weight44,96 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferNaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAK16520.1
Spec:SwissProtIDQ9BJL7
NCBI ReferenceAAK16520.1
Aliases /SynonymsNBL-1-∆Nter, newborn larvae-specific serine protease SS2
ReferencePX-P1128
NoteFor research use only

General Information about Trichinella spiralis NBL-1 Recombinant Protein

Trichinella spiralis is an intracellular parasitic nematode of mammalian skeletal muscle, causing a serious zoonotic disease in humans and showing a high economic impact mainly in pig breeding. Serine proteinases of T. spiralis play important roles in the host–parasite interactions mediating host invasion

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Trichinella spiralis NBL-1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.