Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Mucin-5B(MUC5B)

  • PX-P4752-10
Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9HC84
Molecular weight:
37.43kDa

€329.00

+ 329 loyalty points
Ser5657–Ala5756
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mucin-5B(MUC5B)

Mucin-5B(MUC5B)

Product name Mucin-5B(MUC5B)
Uniprot ID Q9HC84
Uniprot link https://www.uniprot.org/uniprot/Q9HC84
Expression system Prokaryotic expression
Sequence MGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDENLYFQGSCQVRINTTILWHQGCETEVNITFAEGSCPGASKYSAEAQAMQHQCTCAQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPA
Molecular weight 37.43kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser5657-Ala5756
Aliases /Synonyms MUC-5B,Cervical mucin,High molecular weight salivary mucin MG1,Mucin-5 subtype B, tracheobronchial,Sublingual gland mucin,MUC5
Reference PX-P4752
Note For research use only
Molecular Constructor
Ser5657–Ala5756
Product name Mucin-5B(MUC5B)
Uniprot ID Q9HC84
Uniprot link https://www.uniprot.org/uniprot/Q9HC84
Expression system Prokaryotic expression
Sequence MGSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDENLYFQGSCQVRINTTILWHQGCETEVNITFAEGSCPGASKYSAEAQAMQHQCTCAQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPA
Molecular weight 37.43kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser5657-Ala5756
Aliases /Synonyms MUC-5B,Cervical mucin,High molecular weight salivary mucin MG1,Mucin-5 subtype B, tracheobronchial,Sublingual gland mucin,MUC5
Reference PX-P4752
Note For research use only
Molecular Constructor
Ser5657–Ala5756

There are no reviews yet.

Be the first to review “Mucin-5B(MUC5B)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products